SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256389689|ref|YP_003111253.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256389689|ref|YP_003111253.1|
Domain Number 1 Region: 44-508
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 6.8e-136
Family Cellulases catalytic domain 0.000000000114
Further Details:      
 
Domain Number 2 Region: 866-1016
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 6.8e-41
Family Cellulose-binding domain family III 0.0000512
Further Details:      
 
Domain Number 3 Region: 517-661
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 1.78e-33
Family Cellulose-binding domain family III 0.0000205
Further Details:      
 
Domain Number 4 Region: 764-865
Classification Level Classification E-value
Superfamily Fibronectin type III 1.93e-18
Family Fibronectin type III 0.00052
Further Details:      
 
Domain Number 5 Region: 665-760
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000556
Family Fibronectin type III 0.00041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256389689|ref|YP_003111253.1|
Sequence length 1017
Comment glycoside hydrolase family protein [Catenulispora acidiphila DSM 44928]
Sequence
MRLRTPRFRITGPTATLLAGLLVANVLTLAIPTAAHAGTPSATGEFDYAEALQDSMLFYE
SQRSGPLPADNRVSWRGPSDLTDGADHGLDLTGGYHDAGDEVKFGLPEAYSMTALAWGAI
DDKSGYQKSGQWQYLERDLRWGDDYIIKAHPSPHVFYGQVGDGSSDHSFWGPAEVNPEPR
PSYAVTESCPGSDLVGQASAAMAASSIVFQTDDPSYSAKLLAQAKSLYEFADDYRGKYDA
CITGASSFYTSFSGYWDELVWGAIWLYKATGDTAYLTKAETYFANLNKANQTTTPEYAWT
ISWDDSSYASYILLAEITGQQQYIDDAERNLDWFTTGYNGQHVSMSPGGEAQVDVWGTAR
YSANEAYLALDFENWLKSQSLDTARQATYHDFAVRQMNYILGDNPNKESYEVGFTNGGTN
TAWPQQIHNRPAHDSWDQSMSDPPNTRHLDYGLLVGGPTSGDGFTDSRQNYQQTEGALDY
NALFSGALAELTTEYGGTPRANFPPTETPDGPEELMQASPNQTGSNFIEIKAEVVNKSGW
PARHLTNGSFRYYFTLDAGETASQLQLTSPYSQCNAPGPITQYSGSTYYVTISCAGDDVA
PAGQSQFHREVQFRITFPAAHDYTKDWSYQDLVGMATNSTPVNTSHIELYDGSTKVWGTA
PGSGTPVTPPGTPGTPTASAITATGATLAWAASTPGTNAVAGYDVYSVSGATSTKVASST
TTSAPLTGLTPGTAYTFDVVARDSAGNQSPASPTVAVTTTSSSATPPSAPTALTVTATGS
TSVGLSWTAAKAGTSAIASYTVYKTGSPATAVATVAAPAITATVSGLTPSTVYQFYVVAT
DVNGLSSAASSSVSATTTAGTPPPPSSVSVQYETSVTTATTQSFQPLLNVVNNGTSAVPL
SSVTIRYWFTSDGGSSTFATNCWYAVIGCAKVTQSVSSVTATTGADHYVQVGFTTAAGSL
APGASTGQVQSAINKSDWSNFTQTNDYSFNAADTAWTANTNVTVYVNGTLVWGTEPH
Download sequence
Identical sequences C7PX61
gi|256389689|ref|YP_003111253.1| 479433.Caci_0460

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]