SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256389691|ref|YP_003111255.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256389691|ref|YP_003111255.1|
Domain Number 1 Region: 43-231
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.69e-61
Family Xylanase/endoglucanase 11/12 0.00000218
Further Details:      
 
Domain Number 2 Region: 249-334
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.00000000000698
Family Cellulose-binding domain family II 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256389691|ref|YP_003111255.1|
Sequence length 337
Comment endo-1,4-beta-xylanase [Catenulispora acidiphila DSM 44928]
Sequence
MPGNSRLPGARRSRRLRMFIGVVLALFLGAMLPSVPASAATSICSNQTGTNSGYYYQMWS
SGQGSACISLNSGNSYSSTWSGIGDFVAGVGWNPGDKSTKSFTGSLNANGGTSLVSLYGW
STSPLVEYYVMENYVGSPPTAGTYMGQVTSDGGTFNIYEHQQVNQPSIQGTATFEQYLAI
RTSPVSSGTITMSNYINAWSSHGMNLGTLNYQILATEAWGGGSGSSNVSVSSGGGGGGGG
GGGGGGGGGGSCTATLSAGSQGSNWYNLNVAVTGSSNWTVTMNMASPAVVYNTWNVSATW
PSQYVMVAKPNGSGNNFGVTISPNGQWTWPSVSCSSS
Download sequence
Identical sequences C7PX63
gi|256389691|ref|YP_003111255.1| WP_012784709.1.73754 479433.Caci_0462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]