SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256389703|ref|YP_003111267.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256389703|ref|YP_003111267.1|
Domain Number 1 Region: 18-203
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 5.39e-76
Family Xylanase/endoglucanase 11/12 0.000000101
Further Details:      
 
Domain Number 2 Region: 389-493
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 4.19e-34
Family Cellulose-binding domain family II 0.0000614
Further Details:      
 
Domain Number 3 Region: 212-296
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000000000895
Family Cadherin 0.048
Further Details:      
 
Domain Number 4 Region: 303-383
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000011
Family Cadherin 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256389703|ref|YP_003111267.1|
Sequence length 494
Comment glycoside hydrolase family protein [Catenulispora acidiphila DSM 44928]
Sequence
MLAGVMALLPGTAGAATTICSSQTNTVSGYWYSFWTEGSGSACMTFGSAGNYSTSWSNAG
NFVAGLGWSTGGRKTVSYSGSFNPSGNGYLSLYGWTTNPLVEYYITDSWGSYRPTGTYKG
TVTSDGGTYDIYETTRYNEPSIIGTATFNQYWAVRQSKRVGGTITTGNFFDAWASHGMNM
GQYNYMILATEGYQSSGNSNITIGGSVTNTVTVTNPGSQSTTAGSPASVQVHASDSASGQ
TLAYTASGLPPGLSINSGSGLISGTPTTPGSYQVTVTGTDTTGAKGSATFTWTVGSETGT
LVTVTSPGNQTGSVGTAISPIQIQATDSAGQALTYSATGLPAGLSISSSGVISGTPTAAG
TSDVTVTASDSSGSGSATFTWSISGGGTTTGVCHATYARTSEWPGGFTANVTIANTGTTA
VNGWTLGWSFPGDQKITNAWSATATQSGSNVTATNVAYNGSIAPGGTTSFGFQGTYGSND
SSPTAFTLNGTACS
Download sequence
Identical sequences C7PX75
gi|256389703|ref|YP_003111267.1| 479433.Caci_0474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]