SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256389704|ref|YP_003111268.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256389704|ref|YP_003111268.1|
Domain Number 1 Region: 34-217
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 4.2e-50
Family NodB-like polysaccharide deacetylase 0.000000162
Further Details:      
 
Domain Number 2 Region: 248-333
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.000000000105
Family Cellulose-binding domain family II 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256389704|ref|YP_003111268.1|
Sequence length 336
Comment polysaccharide deacetylase [Catenulispora acidiphila DSM 44928]
Sequence
MRIRPRSWRRSLTSGLAAAALALAGALTVGVGAPVAHAATCGGYVGLSFDDGPSNDHTPA
ILNALKQNGLRATMFNEGQYAAAYPAQVQAEINAGMWVGNHSYTHPHLIQESQAQIDSEV
SRTQQAIAAAGGGTPTLFRPPYGETNSTLRAVEAKYGLTEIIWDIDSQDWNGASVSAIVA
ANGRLTNGQVILMHEWPANTLAAIPQIAQVLASHNLCPGMISPQTGRAVAPTGGSGGGGG
GGGGGGGGGSCTATLSAGSQGSNWYNLNVAVTGSSTWTVTMNMVSPAVVYNTWNVSATWP
SQYVMVAKPNGSGNNFGVTITPNGQWTWPSVSCSTT
Download sequence
Identical sequences C7PX76
WP_012784722.1.73754 gi|256389704|ref|YP_003111268.1| 479433.Caci_0475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]