SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256390472|ref|YP_003112036.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256390472|ref|YP_003112036.1|
Domain Number 1 Region: 511-591
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000753
Family Cadherin 0.076
Further Details:      
 
Domain Number 2 Region: 436-501
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000113
Family Dystroglycan, N-terminal domain 0.062
Further Details:      
 
Weak hits

Sequence:  gi|256390472|ref|YP_003112036.1|
Domain Number - Region: 601-682
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0442
Family CBM22 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256390472|ref|YP_003112036.1|
Sequence length 753
Comment Ig family protein [Catenulispora acidiphila DSM 44928]
Sequence
MSLYPTLQEWTENRFREENHVHRVPLRATAGIAAAAITLFASAANGWATAQPSASGSTTS
STATQNPYDPTYGHPYRHGAVPTIQQNQKEKAWNASHPSSNAVNAATGPETLSYGGGIDG
IGVQDGGKSKVYLVFYGSQWGTQSTDSNGNAKFTGDPDGGASVAQQMFKGIGTNGELWSA
DLTQWCDGPGVATGAVACPTNLPASQYINYQSGGVLAGVWEDNSTASPSTASGHQLGQEA
VNAAAHFGNTTAAANRDAYYVILSPHGTNPDSYQGQYCAWHDYNGDSTLTGGAVSSPYGD
IAFSNQPYNMDSGAGCGVGFINSPGTLDGYTITMGHEWHEMMSDQNPAGGWTNNTGSSYN
GQENSDECAWLAPGTTGGGANVSFGSFGTYPEQASWSNDTNACAISHPIVNHGTTETVSV
TNPGNRTSTQGTAIGTLQISATDSAGKSLTYSATGLPAGLSISSSGAITGTPTGTGTSSV
TVTASSGTASGSTSFTWTVNPQGGTETVSVTNPGNQTSTQGTVISTLQISASDSAGKSLT
YSASGLPAGLSISSSGAITGTPSAAGTSSVTVTASSGTASGSTSFTWTVNGTGGGCTAAQ
LLGNAGFETGSASPWTASAGVIDSSSSEPAHTGSWKAWMDGYGTTHTDTLSQKVTIPATC
KTATFAFWLHIDTSETTTSTAYDKLSVQVLNSAGTVVGTLATYSNLNHNTGYTQHSFSLA
SYIGQTITLKFTGAEDSSLQTSFVVDDNGLNVN
Download sequence
Identical sequences C7Q7A7
gi|256390472|ref|YP_003112036.1| 479433.Caci_1270

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]