SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256390880|ref|YP_003112444.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256390880|ref|YP_003112444.1|
Domain Number 1 Region: 153-299
Classification Level Classification E-value
Superfamily Sortase 3.79e-25
Family Sortase 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256390880|ref|YP_003112444.1|
Sequence length 316
Comment peptidase C60 sortase A and B [Catenulispora acidiphila DSM 44928]
Sequence
MNGDEGGFGRASSDETPTEYIPRITDSPVPPAEAQTEVIPRVVYTPPPSSEFPDGSGNGS
ENDRADQGSEPGTRSARTSERAARSARRRLVVLSGFGEVLITLGAVMALYVVYTLWWTNV
EAHKAANTVANQIQQQLAPTAPAGTQPKSVFAPSEGFALMTIPAIGKDDIPVMQGVDKAK
VLDKGAVGHYTTPATAMPWDPTGNFAVAAHRRTYGEPFRYINQLRIGDHVVVETTHGWFV
YALDKELPQTDPTNIGTIAPIPKGGPFTAPGRYITLTTCTPEWASTYRLIWWGHLVRVDP
LNGPPPAELKDPNRHT
Download sequence
Identical sequences C7QBM6
gi|256390880|ref|YP_003112444.1| 479433.Caci_1682 WP_012785897.1.73754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]