SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256391509|ref|YP_003113073.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256391509|ref|YP_003113073.1|
Domain Number 1 Region: 80-141
Classification Level Classification E-value
Superfamily NfeD domain-like 0.000000116
Family NfeD domain-like 0.0053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256391509|ref|YP_003113073.1|
Sequence length 142
Comment hypothetical protein Caci_2314 [Catenulispora acidiphila DSM 44928]
Sequence
MGSMDAMVWAIVAAVLVLLELTTTTLVFVMLGIGAAAAALAAGAGGNVVVQFAAFGAVSV
ATLVFARPTAMKRLHGGPEHRQGIDTLIGREAFVVEKVDAHDGRVRISGEIWSARAYDGQ
TEYEVGDRVDVAQIEGATALVL
Download sequence
Identical sequences C7QJK9
WP_012786525.1.73754 479433.Caci_2314 gi|256391509|ref|YP_003113073.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]