SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256391869|ref|YP_003113433.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|256391869|ref|YP_003113433.1|
Domain Number - Region: 1257-1311
Classification Level Classification E-value
Superfamily Cadherin-like 0.0612
Family Cadherin 0.068
Further Details:      
 
Domain Number - Region: 289-378
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.0817
Family SGL-like 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256391869|ref|YP_003113433.1|
Sequence length 1319
Comment hypothetical protein Caci_2676 [Catenulispora acidiphila DSM 44928]
Sequence
MSAIDDEFQHVMDSYTRDTRAARKAVQADRDQQIAMLYPDARTFRLKQADAISDTEKGEK
ALALVPETLTLVTPDLRDPKRDHLFVGPHPVPSVGMTWNPVHRELSFLTSDGEHKISGHL
SMTHNRLRAYGTVSVDGQSVAVEYHVDPQRYKMKVAKGAAYLAADRSITWDTTTDRWKNA
EWSTDYELGFTYGINGEEVIGDEKLYTFLAKFDNPKTGRSWEPVPETYGGYLNKQRRINF
GLLSDYKPPSGTGTELFPYRFSCTLSEFAADFTGGLVVDPPGSTNPLVYGAIGVWTGRGI
AGLYHLGDAGHGAVRIVAVHAGRLYAGSVAAAHTEIDGDVLVWSGLDKVAADQAGIPTEG
RLAFSPDGGRVLHSSFGATGERVHPDQALDLVSRIAVTGLAASLRHAVALANPGPGATHD
LSELMAMSQFTRNEKDEYYDKVQEDSMEDFYKILQNYMDPELRSTFFHRDPPALDQTLRD
IAKTKGKKGTDPFPWFKSLSVAYTATCVGKYSDDPAAKTLNTIRAEQWLSQTTSGSDVMD
AQAPLLYANRWSERPANKHLGWYLADQKANSVKYAGDIDATTEAWLKEAREANVGTPEQL
AELEKSIRTIGDHAKKHDQFWAFAVYIGASRPSYMNMLESFIKLGGEVDGSEFSQRVQRT
VATLTVLDTSGVIAQEYAYMLQLFELSTLLPQMADLEGGVGGFNFAVKAIIDKFVEKYLG
SKDPALDEAAKLLKEHASQDVVGKMLAILRTTAAVGYGLFNWGFLMAQYTSKCAQLLGSL
PAMVVRLGALAAMGTLMSFFLDGTADWNSLSDEQIGFISLAGANILALNALALIKRGVAL
HEVWNPAKGFWKNAKMFFSSKLLAKAQATATNGLRGYLLQEGGPKVPAGRITFKQWWANR
QAAAAAPLVPKPSQSFARRLFGKNLTQFMARALAGAFAIVGIVMSSIDLHHSGEPLEKAA
HAMFLLAACLELVAVIGAWALGTSALAVGGMLVSTMFSIVSGIGFLALVAGAILLIVLMT
RPQQTPVEKFAKERAGDLYMPYKAAIETFRIYKPIGEPQRAGIAVFATTDQSHALRIASD
GKVTQAPFDATGHTAFYVSVDEFGRTQLGAPIVNTKGKPCLMSLAVDDAGAIAAQDYASD
LPEPEPKLLWYADIQGEGTYQDTTPDVKELKSAPFKLRSVFFVDSKKEVRWLAADGASGW
KTTTDAAEAATVRLEMVATKPTELAMTDVSWFTVAHDEVTGPGLQVPGSVPQEWSISPAL
PTGLEFDKAEGTISMRKGADIPAAPKQEYTLTVKNGVGSAATTFSLEVVEPSEEIMAAA
Download sequence
Identical sequences C7PZD5
479433.Caci_2676 gi|256391869|ref|YP_003113433.1| WP_012786885.1.73754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]