SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256391920|ref|YP_003113484.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256391920|ref|YP_003113484.1|
Domain Number 1 Region: 186-498
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.33e-99
Family Alpha-L-arabinofuranosidase B, N-terminal domain 0.0000000468
Further Details:      
 
Domain Number 2 Region: 35-139
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 1.53e-29
Family Cellulose-binding domain family II 0.000048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256391920|ref|YP_003113484.1|
Sequence length 499
Comment alpha-L-arabinofuranosidase [Catenulispora acidiphila DSM 44928]
Sequence
MKLSHYRSWLSVGAAATIVAAAGAVSMTAAPTAQAAGGCQVDYSVSSQWQGGFGANVSIT
NLGVPTTGWTLTWTFSAGQTITQLWNGTDTQTGGDVAVTNAPYNGAIPTGGSTSFGFNGS
WSTSNPAPVSFALNGTTCIGSGPSGTPTTTPSSPPTTTPSSPPSSTPSSTSSTPSTPPSS
SSTRLPCDIYAAGGTPCVAAHSTVRALYSAYGGALYQVRRSSDNATKDISVLTPGGYANA
ATQDSFCAGTSCVITVVYDQSGHGNSVAYQGPGGAGGSDTPASATRESLTAAGHKVYDLY
INPGNSYWHNGASSGMPVGSQPQGAYMVTSGLHVNSGCCFDYGNSETDRRADGAGAMDAI
NFSTSCWFGGCTGSGPWVQADLEYGLFPGGSSSWNPNQRAFADKYVTAMLKNNGSTQMAL
KGGSAQTGSLTTLWSGALPRGYNPMKQQGAIILGSGGDCCASNTNLSLGTFYEGAIVAGY
PSDATDSAVQASIVAAGYQ
Download sequence
Identical sequences C7PZI6
479433.Caci_2728 gi|256391920|ref|YP_003113484.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]