SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256391921|ref|YP_003113485.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256391921|ref|YP_003113485.1|
Domain Number 1 Region: 168-478
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 7.75e-137
Family Alpha-L-arabinofuranosidase B, N-terminal domain 0.00000000188
Further Details:      
 
Domain Number 2 Region: 33-139
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 1.88e-29
Family Cellulose-binding domain family II 0.0000702
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256391921|ref|YP_003113485.1|
Sequence length 479
Comment alpha-L-arabinofuranosidase [Catenulispora acidiphila DSM 44928]
Sequence
MNRSRSRAVLAVGASAALVGAGVALSNMTAHAAGAGCSVAYSITSQWGGGFGANVSVTNL
GDPVSSWTVGWSFGAGQQVSQAWNATVTQSGAQVSAASMSYNGVLASGGSTSFGFNGTWN
NSSNPIPTAFTMNGVACTGGVSSSSSPSTSPSTSPSSSTSVPPPSQEPCDIYAAANTPCV
AAHSTTRALYGSYTGNLYQVRRSSDNATANIGVLSAGGPANAAAQDSFCANTSCVITVIY
DQSGRGNNLTQAPAGGAAGGPDNLANATSAPTTLNGHKAYGVYVATGTGYRDNATHGIAT
GDASEGEYAIFDGTHYNGGCCFDYGNAETDSRDDGNGTMEAIYFGNIRVWGYGSGNGPWI
MADLENGLFSGVNQHLNSNDPTINYRYTTAMIEGGQNQWAILGGNAQSGNLSTFYSGPRP
NVSGYNPMRKQGAIILGTGGDNSKGSDGTFYEGVMTTGYPSAATENAIQANITAAGYGR
Download sequence
Identical sequences C7PZI7
WP_012786937.1.73754 479433.Caci_2729 gi|256391921|ref|YP_003113485.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]