SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256391935|ref|YP_003113499.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256391935|ref|YP_003113499.1|
Domain Number 1 Region: 271-375
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 1.74e-33
Family Cellulose-binding domain family II 0.0002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256391935|ref|YP_003113499.1|
Sequence length 376
Comment cellulose-binding family II protein [Catenulispora acidiphila DSM 44928]
Sequence
MLRRLLMSILAAVVSLAGLLVPVAANAATTPGCTGGVSVSQFTFNPSSVPLGGHSELTLV
LQNCGSQTVQGSTIWYGQFAGQGCPVLDPANPSPFTIAPQGSLTLSKTYGDPGLTGCHPT
SLHMSTGVSVTGVGTVATPTATLQFVPACDGDTGFAVDRLDFSPVAVAPGRLSTATLVLQ
NCTAQTVTGSTTWIPRLTGSGPDLPPGCPALDPVAFPASIAPGATATATLQLGDPVASCL
ATGLLLTVNVYETGVTNPVYIAQANLGIIQPAPDSCHVTYTPANWPGGFTANVTITNTGT
AAINGWTLGFTFPGDETVTHGWNASVTQKDTTVTASNLAYNATIAPGASQSFGFQGTWAA
DNTPPATFAVNGELCY
Download sequence
Identical sequences C7Q0Y3
gi|256391935|ref|YP_003113499.1| 479433.Caci_2745 WP_012786951.1.73754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]