SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256391982|ref|YP_003113546.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256391982|ref|YP_003113546.1|
Domain Number 1 Region: 94-376
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.95e-48
Family beta-glycanases 0.000000252
Further Details:      
 
Domain Number 2 Region: 574-679
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 3.84e-31
Family Cellulose-binding domain family II 0.00016
Further Details:      
 
Domain Number 3 Region: 373-465
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 5.32e-20
Family Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 0.0037
Further Details:      
 
Domain Number 4 Region: 476-569
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000195
Family Fibronectin type III 0.00026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256391982|ref|YP_003113546.1|
Sequence length 681
Comment cellulose-binding family II protein [Catenulispora acidiphila DSM 44928]
Sequence
MPESQPGVGALPLQGPLSEKPGPESSIAEIQETTLTPRNETTATGPEFPSRRTVLAALGA
VPVLAVAAPSMAATAAPAAASAVVVDPSALRQTIRGYGGMNHPEWAGDLTAAQRDTAFGN
GTGQLGFSMLRIHVDEDQNNWSRELATAQRAVALGATVFASPWNPPASMVETFTRGSQTN
AHRLRHDMYGAYAQHLNSFYQYMKTNGVDLYAISVQNEPDYASTWTWWTASEIVTFLQNN
AGAIGTRIIAPESFQYVKSMSDPILNDATALANLDILGAHLYGTSYANFPYPLFQQKGQG
KELWMTEVYYPNSTDSADLWPAALGVGEHMHHAMVDAEFQAYVWWYIRRSYGPMREDGQI
SKRGALMAQFSKFVRPGYVRVNATANPQTNLLTSVYKGPSTLVIVAVNSATSTLSQQFTL
SNTTASSVSAWVTDASRNVASTSAPSVSNGSFTATLPAQSVTTFVITVGSSTGSDTQAPT
APGTPTATGITATSATLSWPASTDNVGVVGYDVVRVSGTTETAATSSTTTQGTVTGLTAS
TAYTFAVYARDAAGNRSTRSATVSVTTSASGGTGTGACGVTYQVTGSWTGSFQGQIDIHN
TGTTALNGWTLTFTFTAGQTITQMWGGTPAQSGSKVTVTPADYNSSIPAGGSVTVGFLGT
AGSTNPAPTGFTLNGGTCTTA
Download sequence
Identical sequences C7Q130
WP_012786998.1.73754 479433.Caci_2792 gi|256391982|ref|YP_003113546.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]