SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256392480|ref|YP_003114044.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256392480|ref|YP_003114044.1|
Domain Number 1 Region: 124-244
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 0.00000000000018
Family GntR ligand-binding domain-like 0.021
Further Details:      
 
Domain Number 2 Region: 38-114
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.000000000000432
Family GntR-like transcriptional regulators 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256392480|ref|YP_003114044.1|
Sequence length 250
Comment GntR family transcriptional regulator [Catenulispora acidiphila DSM 44928]
Sequence
MANTAGKFGPYPAPVLTAPVRSTGTSSSTAAARLPVRQQTGAELIRSRIALRVRLGVLAS
GERLPDTGVIAEELGMSEMTVRRALETMCQDGLLDRRRGRVGGTFVATNWDAVIEAFRDA
DQAASLEDFHLLLECGLVARSAGELPPDWASGLQAVVEEMNATVDHAELLRLETCFHLGL
AEALGNGMAGEEVADLLGRLCLLATVPDAGRLQEANKHHADLLTALELGRLDAAVGAVKA
HCLAATSPTS
Download sequence
Identical sequences C7Q7L0
479433.Caci_3296 WP_012787496.1.73754 gi|256392480|ref|YP_003114044.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]