SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256392648|ref|YP_003114212.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256392648|ref|YP_003114212.1|
Domain Number 1 Region: 402-710
Classification Level Classification E-value
Superfamily Soluble quinoprotein glucose dehydrogenase 2.62e-34
Family Soluble quinoprotein glucose dehydrogenase 0.0000459
Further Details:      
 
Domain Number 2 Region: 199-375
Classification Level Classification E-value
Superfamily Fibronectin type III 1.38e-24
Family Fibronectin type III 0.00033
Further Details:      
 
Domain Number 3 Region: 60-192
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 5.6e-24
Family Discoidin domain (FA58C, coagulation factor 5/8 C-terminal domain) 0.052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256392648|ref|YP_003114212.1|
Sequence length 729
Comment coagulation factor 5/8 type domain-containing protein [Catenulispora acidiphila DSM 44928]
Sequence
MRKKRFTRIRGLVLIGCAAVLAVAGTVSTGSGTAVAAQATAANPAVRVDQGSLTNQATPA
ADALLSLNKPATASSSGGCCAAPNVDDGVSTTRWASGAGVDPQWIYIDLGAMAHVSRVRL
QWDTSCATAYEVDVSADHTTWTKIYSTTAGKGGVEDLTSLDGNGRYVRMYGTKRCRSDSS
HGYSLQELGVYGTVGSDTTPPTPPGTPTLVSDTPNSVTIGWSASTDNVGVSGYDIYHDGQ
LCAQVNGSTLTGTCGSLNPNVSYGFYVNARDAAGNVSQPSGTLNVTTPPSSDTTPPTVPG
TVHSTAVTSTSVTLGWTASTDNVAVAGYRVYNVVNGTRTKVGTADANATTTQVDGLTPST
AYHFQVTAYDGNGNESAGSTPILDVSTSASSSCTPSQGVCTVTQVGTDDDVVWGLVTLPD
GTILFNERDAHDIVHLNPKTGAKKTIGTVPNVQSTDGEGGLTGLEINPVSFSSDHWLYIM
HTSPTDNRIVRIKYDPASDTLQTSTEQILLTGIARNKFHNGGRLRFSPDGKYLYAGTGDA
QNGANAQNTSSLNGKVLRINPDGTIPTDNPFHNAVWSYGHRNVQGLAFDSQGRLWEQEFG
NSVMDETNLIVKGGNYGWPSCEGTSGTCGTAGFIAPKHTYPVANGSCSGITIIRDFLYVA
CERGTRLYREQISGSSLTNVQTFFDGTYGRLRTVEPAPDGGMWMATSNGGDKDSTPHNST
NQIFHVTVA
Download sequence
Identical sequences C7Q951
WP_012787664.1.73754 479433.Caci_3465 gi|256392648|ref|YP_003114212.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]