SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256392675|ref|YP_003114239.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256392675|ref|YP_003114239.1|
Domain Number 1 Region: 51-172
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 6.81e-34
Family Galactose-binding domain 0.022
Further Details:      
 
Domain Number 2 Region: 187-309
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.4e-31
Family Galactose-binding domain 0.026
Further Details:      
 
Domain Number 3 Region: 320-403
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000000118
Family Cadherin 0.031
Further Details:      
 
Weak hits

Sequence:  gi|256392675|ref|YP_003114239.1|
Domain Number - Region: 680-834
Classification Level Classification E-value
Superfamily Pectin lyase-like 0.000659
Family Pectin methylesterase 0.074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256392675|ref|YP_003114239.1|
Sequence length 962
Comment coagulation factor 5/8 type domain-containing protein [Catenulispora acidiphila DSM 44928]
Sequence
MKAFSSAGTLHRRPLNRPLNAVFLLLVVLSMAAYAVVAPSSAHAADSLLSQGKTTTASST
ENAGNPAANATDGNTATRWSSAFSDPQWLEVDLGASATVDKVVLNWEAAYATAFQIQTSA
DGTNWTSIYSTTTGTGGVQTLTVAGTGRYVRMYGTARATGYGYSLYEFQVYGTTGTGTGG
GCSTTNAALNQPATASSAENAGTAASAAVDGNLGTRWSSAFSDPQWLQVDLGSTQSICQV
VLNWETAAAKAYQIQTSANGTTWTSIYSTTTSPGGTETLNVSGSGRYIRMYGTARATQYG
YSLWEFQVHTGTAGGGTGVTVTNPGAQSTTVGTSANVQIQASDSTAGQTLTYSATGLPAG
LTINSASGLISGKPTATGSSAVTVTVTDGTGAIGTASFTWTVTGIATGCTNQSNTPNFGP
NMHIFDPSMSSASIQSTLDTVFNNQKLNQFGTERDALLFKPGTYSNTANIGYYTSIQGLG
QNPDDVTINGDVTVDAFDGTGNATQNFWRSAENMAVNPSAGNTRWAVAQAGPFRRMDIHG
GLQMYPASYGYASGGYVADSKISGQASSVSQQQWYTQDSNLGSWSGSVWNMVFSGVTGAP
AQSFPNPPMTTLATTPVSRDVPYLYVDSSGNYHVFLPSLRTNASGASWANGATPGTSVPM
SQFFVVTPSNTASQMNTALAQGCSLFFTPGVYTIDQTLNVTNPNTVVLGTGFPTLIPTNG
ITTMQVGDVDGVRISGLLMDAGTTNSASLLTVGTQGSTANHSANPDSVQDVFFRIGGDIA
GKATDSLVVNANNTLVNDIWAWRADHGNGGTVGWTTNTADNGLTVNGNNVLATGLFVEHY
QKNEVVWNGQGGETIFLQNENPYDPPNQAAWMNGSTNGYPAYKVASNVTSHQAYGLGSYC
YFNVNPAVVNDHAFEAPNTSGVQLHDMLTVSLGGVGVISHVINQIGGATPSNTTPSDVTS
FP
Download sequence
Identical sequences C7Q978
479433.Caci_3492 gi|256392675|ref|YP_003114239.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]