SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256392756|ref|YP_003114320.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256392756|ref|YP_003114320.1|
Domain Number 1 Region: 90-231
Classification Level Classification E-value
Superfamily Sortase 0.0000000000000785
Family Sortase 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256392756|ref|YP_003114320.1|
Sequence length 247
Comment peptidase C60 sortase A and B [Catenulispora acidiphila DSM 44928]
Sequence
MSWLTRLFGSGRRRLLASAAAVLLLASAGGLALGFAAQHHPPQPPASAALPAAGVPNAAS
AGTTPSTSPAPASPSPAATPAAPATPTKPAAPATPTAAPTAISIPEIGVHHTLIQLGQNS
DGTIQTPPLTDPSIPGWYRYSPAPGQVGPSVIVGHIDGTTGAKGVFYNLGALRPGDTVDV
SRSDDTVAVFRIDGINKYAKSAFPTATVYGNTTNPQLRLITCAGPFENQHYLDDIVVYAS
LTAIHPA
Download sequence
Identical sequences C7QAI0
gi|256392756|ref|YP_003114320.1| 479433.Caci_3574 WP_015792208.1.73754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]