SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256392785|ref|YP_003114349.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256392785|ref|YP_003114349.1|
Domain Number 1 Region: 41-672
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 3.47e-278
Family Cellulases catalytic domain 0.000000000000943
Further Details:      
 
Domain Number 2 Region: 873-970
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 1.19e-30
Family Cellulose-binding domain family II 0.00029
Further Details:      
 
Domain Number 3 Region: 778-865
Classification Level Classification E-value
Superfamily Fibronectin type III 7.46e-17
Family Fibronectin type III 0.0000704
Further Details:      
 
Domain Number 4 Region: 682-769
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0000000000000019
Family Fibronectin type III 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256392785|ref|YP_003114349.1|
Sequence length 973
Comment glycoside hydrolase family protein [Catenulispora acidiphila DSM 44928]
Sequence
MTKKLSRRQFATAAGGAVLASAVAPSMSRAASVAPAAASAATDAYTQQFLTQYKKIKDPA
NGYFSAQGIPYHSVETLIVEAPDYGHQTTSEAFSFWMWLEATYGRVTGDWTAFNNAWTTA
EHYIIPQHVDQPSNSSYNPNSPATYAPEWPDPSSYPSPLNTSVSVGQDPLANELTSTYGT
SDIYGMHWLMDVDNKYGYGNTPGTGGEAGPSATGPSYINSYQRGAAESVWKTIPQPTTDL
FNYGGPNGYLDLFVAQSGSYSKQWKYTTAPDADARAIQAAYWAYRWASAQGAQGQIAASV
AKAAKMGDFLRYSLFDKYFKQIGNCTNASSCAAGTGRGSEHYLLAWYYAWGGAEPGGGWA
WRIGDGAAHQGYQNPLAVWAMTNIAALTPMSPTAKSDWTASLTRQMEFYQWLQSAEGAIA
GGCTNSWNGSYSVPPSGDSTFYGMAYDWEPVYHDPPSNNWFGMQAWSMERLAEFYYVTGN
ATAKTILGKWITWASSKTTVTATNFQIPSTLGWTGQPDTWNPTSPGGNSGLHVTVADYGN
DVGVAAAYVKTLTYYSAKSGDTASGALAKSLLDAMATFADTAGIATPETRTDYSQFNDTV
YVPSGWSGKMPNGDPIAPGATFLSIRSWYKNDPAWPKVQAYLNGGSAPTFTYHRFWAQAD
IAMAYAVYGELIAGGGGTGGDTTPPSVPTGLTVTGTTSSTASLSWTASTDNIGVAGYTVY
RGTTVAGSATTPTFTDSGLAASTQYSYTVTAHDAAGNVSAASAAVKATTTAGTGGGDTTP
PSVPTNLAVTATTSSSVSLSWTASTDNVAVTGYTVYRGTTVAGTTTSPTFTDSGLTASTQ
YSYTVTAHDAAGNVSAASAAVKGTTSGTGGGTGPTCTATYSVTSDWGNGFNGNVTITNTG
TTATKSWKVTWTWGGNQTITNTWNATETQSGKAVTATNAPYNNVIAPGASTSFGFNASYS
GTNGAPTVTVTAT
Download sequence
Identical sequences C7QAK9
WP_015792237.1.73754 479433.Caci_3604 gi|256392785|ref|YP_003114349.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]