SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256392866|ref|YP_003114430.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256392866|ref|YP_003114430.1|
Domain Number 1 Region: 38-161
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 2.06e-33
Family Galactose-binding domain 0.03
Further Details:      
 
Domain Number 2 Region: 175-297
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 9.22e-33
Family Galactose-binding domain 0.012
Further Details:      
 
Domain Number 3 Region: 309-392
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000832
Family Cadherin 0.056
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256392866|ref|YP_003114430.1|
Sequence length 674
Comment coagulation factor 5/8 type domain-containing protein [Catenulispora acidiphila DSM 44928]
Sequence
MTGIKRRPYAILVLMIALVASVMLVSTAPKAHAAGTLLSQGKPATASSAENAGTAATAAV
DGNTGTRWSSQFSDPQWLEVDLGQASTISQVVVQWETASAKAFQIQTSNDGTNWTSIYST
TTGTGGTQTLNISGSGRYVRMYGTARNTAYGYSIWEFQVYGSAGTGTGGGSCVNNAALNH
PATASSAENAGTSAANAVDGNTGTRWSSLFTDPQWLQVDLGSTQQICGIQLQWEAASGKA
YQIQTSNDGTNWTSVYSTTTGPGGTENLTVSGSGRYVRMYGTARNTAYGYSLWEFQVLTA
TVVGGDMITVTNPGNQTAVVNTAVRLQMGATDSVAGQTLTFTATGLPAGLSISSSGLITG
TPTTAATSSVTVTAKDTTGATGSTTFGWTVNATGGGTGAPPTAFWGNVSAIPPAAHVMEF
MIQNQTNGQYPDSQVYWSFNGQTQSIAQQRYIDMPANSAGRMYFYLGTPNGPYYDFIEFT
VGTTFINVDTTRVDRFGLKLALLVHDHSGNEQEIGENYATFQESRTSTFNRFQSSVPTEF
KELATDNAPYGIPSPGNDAAFQSGGPYANYFQAYAAANGDTADSTPQIFGCGGTLSGNPQ
LCAGLNRHVAQLPAAQQSIPANFYQAGPANYYAQFWHQNAINGMQYGFPYDDDAGQSSDI
SVNNPQYAVVAVGW
Download sequence
Identical sequences C7QBX0
479433.Caci_3687 gi|256392866|ref|YP_003114430.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]