SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256393013|ref|YP_003114577.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|256393013|ref|YP_003114577.1|
Domain Number - Region: 35-69
Classification Level Classification E-value
Superfamily Thiamin pyrophosphokinase, catalytic domain 0.0497
Family Thiamin pyrophosphokinase, catalytic domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256393013|ref|YP_003114577.1|
Sequence length 77
Comment hypothetical protein Caci_3837 [Catenulispora acidiphila DSM 44928]
Sequence
MPSVTKGAAVPSVLQPAIVCGRLAVSAGFRRGFYDALTARRDELFELADAVLCTDGAVKT
LVELALAPEYQRRHGAW
Download sequence
Identical sequences C7QDE3
gi|256393013|ref|YP_003114577.1| 479433.Caci_3837

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]