SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256393240|ref|YP_003114804.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256393240|ref|YP_003114804.1|
Domain Number 1 Region: 48-352
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.37e-85
Family NagZ-like 0.0000732
Further Details:      
 
Domain Number 2 Region: 373-600
Classification Level Classification E-value
Superfamily Beta-D-glucan exohydrolase, C-terminal domain 5.62e-53
Family Beta-D-glucan exohydrolase, C-terminal domain 0.0014
Further Details:      
 
Domain Number 3 Region: 817-935
Classification Level Classification E-value
Superfamily Ricin B-like lectins 4.22e-37
Family Ricin B-like 0.00045
Further Details:      
 
Domain Number 4 Region: 953-1071
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1e-36
Family Ricin B-like 0.00033
Further Details:      
 
Domain Number 5 Region: 722-807
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000659
Family Cadherin 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256393240|ref|YP_003114804.1|
Sequence length 1072
Comment glycoside hydrolase family 3 [Catenulispora acidiphila DSM 44928]
Sequence
MSRTARPRLGRVRVLISLAALSASAVATYAAVPGAQAAPAASAASAACPWVGSTAPIPQR
VSQLLAAMTLNQKVQLMTGSSGSSYVGFTPAIGSLCIPAMNLEDGPAGVADGMTNVTQLP
APVDVAATFDTSAEQSFGQLIGAEEAAKGTTVDLGPTINIVRDPRWGRAFESVGEDPYLN
GQMGAADIRGVQSTGTMAQVKHLVAYNQETNRNSPSDNVIASNQTLEEIYDPAFQTSVQK
GAASSVMCSYSTINGTYACQNPTVLNTVLRNQFGFGGFVTSDWGATHAGAASVNAGLDQD
MPGDNTYYGSALISAVNSGQVSQATINTAVSRILTEEFAFGMFDKPPTGSPGATATSSAN
QTAGEHLAEQGTVLLKNSGNVLPFGSGDTSIAVIGADASTNVQSAGGGSASVNSSGTVTP
LQGITSAAPAGTTVSYDSGSSTSSAAALAGRSSVAVVFVSTNESEGSDLSGIDLSSANNS
LISAVANANPNTVVVLNTGSAVTMPWLSSVKGVLEAWYPGQSDGTAIARILYGTTNPSGH
LPVTFPTSLSQVPASTSAQWPGTNGQVQYSEGVDVGYRWYDSKGLTPLFPFGYGLSYTSF
SYSNLQISSLPQGGAATVTATVTNTGSRAGADVAQLYVSDPAASGQPPRQLEGFARVNLQ
PGQSQTVSFPLTEQNLHYWSTSTNNWATSTGNYGVAVGDADSASALTLSGTLAVAANQLG
QPVSVTNPGPQEGVAGAAVSVQVTAGDTTAGQTAAFTAAGLPAGLAISSSGKITGTPITA
GTSTVDVTAKDGNGATATTSFVWTVAASSGGVPTTPLVGYQGLCLDVAAANNADGTAVQV
YTCNGTNSQQWTEEADGTVHSLGKCLDIAAGGTANGTAVDLYTCNGSGAQQWQPQTNGTL
RNPASGRCLDDTGSGLSGTKTEIYDCSGAANQVWKSPAGTSTGGGGGSTGPITGYQGMCV
DVRSANSADGTPVQVYTCNGTTAQQWTVESNGSLQALGKCLDVNAAGTANGSLVQLYTCN
GTVAQVWQAQSNGELVNPHSGRCLDDTASGGSGTQLQIWDCTASANQKWQLP
Download sequence
Identical sequences C7QGB8
479433.Caci_4099 WP_015792692.1.73754 gi|256393240|ref|YP_003114804.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]