SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256393355|ref|YP_003114919.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256393355|ref|YP_003114919.1|
Domain Number 1 Region: 51-398
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.66e-93
Family beta-glycanases 0.0000000000136
Further Details:      
 
Domain Number 2 Region: 508-604
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 5.02e-27
Family Cellulose-binding domain family II 0.00029
Further Details:      
 
Domain Number 3 Region: 416-503
Classification Level Classification E-value
Superfamily Fibronectin type III 2.89e-17
Family Fibronectin type III 0.0000428
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256393355|ref|YP_003114919.1|
Sequence length 608
Comment glycoside hydrolase family protein [Catenulispora acidiphila DSM 44928]
Sequence
MAAALIAASVMTFAGVAAQPATARTDAAAAHTTAATAGTTGTAPAATAAAGAGYWHTSGR
EILDSANQPVRIAGVNWFGFETSNDVVHGLWSRDYKSMMDQMKSLGYNTIRLPYSDDIFK
PGTMPNSINFYQMNTDLQGLTSLQVMDKIVDYAGSIGLKVILDRHRPDAGGQSALWYTST
VPESTWINDLKAIATRYQGNPAVVGIDLHNEPHDPACWGCGDTTIDWRLAAERGGNAVLS
VNPSLLIFVEGVQTFNGSSYWWGGNLQGAGQYPVQLSVANRVVYSAHDYATSVASQPWFT
DPSFPSNMAGIWDKNWGYLFNQNIAPVWVGEFGTTLSATTDQVWLKTLVSYLRPTSTYGG
DSYQWTFWSWNPDSGDTGGILKDDWNSVDTVKDGYLTSIKAPAFGGGGGGGGGDSSPPTA
PTNVAATVTTSSSVALSWTASTDNVGVTGYDIYRGSTLAGTSAGTTFTDSGLTPSTAYTY
TVKAYDAAGNLSAASAAVSATTQGGGSNAGCTAAYTVSNQWNNGFTAAVTITNSGTAATH
SWKVTWTWPGGQQVSNAWNATEAHSGQSETFTAVSSDAVVAPGGTTSFGFQASYNGTNPA
PTPVCTAS
Download sequence
Identical sequences C7QI33
gi|256393355|ref|YP_003114919.1| 479433.Caci_4214 WP_015792807.1.73754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]