SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256393426|ref|YP_003114990.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256393426|ref|YP_003114990.1|
Domain Number 1 Region: 372-462
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 6.07e-25
Family Cellulose-binding domain family II 0.0017
Further Details:      
 
Weak hits

Sequence:  gi|256393426|ref|YP_003114990.1|
Domain Number - Region: 50-237
Classification Level Classification E-value
Superfamily Barwin-like endoglucanases 0.000237
Family Eng V-like 0.028
Further Details:      
 
Domain Number - Region: 221-295
Classification Level Classification E-value
Superfamily PHL pollen allergen 0.0889
Family PHL pollen allergen 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256393426|ref|YP_003114990.1|
Sequence length 472
Comment cellulose-binding family II protein [Catenulispora acidiphila DSM 44928]
Sequence
MRSPRPAPPSRRRRAVVRTAVAAAAALVVALTAAVLTSPAQALGVGGTSSPVTGNATHFD
GLGAPYGGCGVPQANLDSQDFIALNVFNTPGNYNQFTRPVPPAQASILGMFDNGLNCGRW
VKVSIGDLCTGTNDGAPNQPFCRNGSWVADKYNGATLNMLVADSCADSNAWCRDDPYHID
LHTDSINRFQLNGSAVGDLLNHWNNRQVSWQFISAPGYSGDINIGFMQGAQVYWPAISVS
HLANGIHGVQYLSASGTWVSAAMDSDMGQSYIIAPTATAGSSYQIRVTDASDNLINGGQV
YSFSLPSSCGGSCSAAYTQVPYTTTPGSGPSSPSSSPSTTPSTSASSPSTPPSSPSSSGP
STPPSSPSSSAPASGCSVTSSVTGSWSSGYQLAFTVTNTGKVASSQWAVRFSFAGSQTIA
NSWNVTATQSGQAVTANSVSYNGSLAPGAATSWGMVVNGANQPLGGISCVAS
Download sequence
Identical sequences C7QJR1
479433.Caci_4285 WP_015792878.1.73754 gi|256393426|ref|YP_003114990.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]