SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256393427|ref|YP_003114991.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256393427|ref|YP_003114991.1|
Domain Number 1 Region: 32-229
Classification Level Classification E-value
Superfamily E set domains 1.54e-42
Family E-set domains of sugar-utilizing enzymes 0.0013
Further Details:      
 
Domain Number 2 Region: 243-343
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 4.95e-29
Family Cellulose-binding domain family II 0.0005
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256393427|ref|YP_003114991.1|
Sequence length 347
Comment chitin-binding protein [Catenulispora acidiphila DSM 44928]
Sequence
MSRKIPRKVAGVLLALAGLIATVTFAPTASAHGALMIPGSRTFFCYEDGLTSTGQIVPQN
PACQAAVAQSGTTPLYNWFAVGNRSGATSGGTAGFIPDGKLCSGNSNYYDFSGFDQVSTA
WPVTHLTSGADITINYNRWAAHPGTFSLYITKDGWDQTKPLTWADMEPAPFSTATDPTNT
GTVATLQSYYSWNAKLPANKTGHHIIYSVWARSDSSETFYGCSDVVFDGGTGQVTGIGAT
APPPVSAPCKATYSITNSWSGGFQGQITVTNPGTTPMNKWTVGWVLADGESVVSAWNGTL
SQSGSLASMKSADWNSQLAAGASTSVGFVANQTTAPAQPESLSCTSP
Download sequence
Identical sequences C7QJR2
WP_015792879.1.73754 479433.Caci_4286 gi|256393427|ref|YP_003114991.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]