SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256393430|ref|YP_003114994.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256393430|ref|YP_003114994.1|
Domain Number 1 Region: 52-392
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.39e-38
Family beta-glycanases 0.0021
Further Details:      
 
Domain Number 2 Region: 585-694
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 4.33e-24
Family Cellulose-binding domain family II 0.00023
Further Details:      
 
Domain Number 3 Region: 496-584
Classification Level Classification E-value
Superfamily Fibronectin type III 9.79e-17
Family Fibronectin type III 0.0014
Further Details:      
 
Weak hits

Sequence:  gi|256393430|ref|YP_003114994.1|
Domain Number - Region: 402-482
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.036
Family alpha-Amylases, C-terminal beta-sheet domain 0.064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256393430|ref|YP_003114994.1|
Sequence length 699
Comment cellulose-binding family II protein [Catenulispora acidiphila DSM 44928]
Sequence
MRVGRVGTLATAGLLAVSGAVAAVPGGSAAASAVTAASSTAAASSVNVSVNTLEGLGTIP
ATGYGLNSAVWDSQMNTPSVQGLLGQAGIGMLRYPGGSYGDMYHWQTNTAPGGYVAPGTD
FDSFMGTVKTIGAQPILIANYGTGTPEEAAAWVQYANVTKGYGDKYWEVGNENYGNGYYG
SGWEADDHSSKSPTTYAQNVIQYSKAMKAVDPTIKVGAVLTMPGNWPDGSVATGDSADWN
RTVLSIAGSAVDFVIVHWYPNGTGAATALTEPDQLPGELSQLRSEINEYGGANASRLGVA
LTEVNAGVDEDTQPDALFGADTYFTALEQGVFTVDWWDTHNGPTQISTAPDGATDYDDWG
VLSSGTCVGSVCEPAMNTPFPSYYAISMLSKLGHPGDQMVRAGTDQQLVAAHAVKQANGN
LAVMLVNKDPANAYTVNLHYSGYTPSTATPTVYTYGDEASSITSAAQGSSAVQTLPPYSI
ETVVLTPSGNHVSTLKAPGSPVVSQVTDTQATVSWTPSSGGTATRYEIYRQFGTTSELLA
ESTSTSATIANLVPGTGYTFNVLATDQSGNLSPPSDPLTFTTGTPAASTCAVDYQVTSGW
GSGYVTAITVTDTGPAPINGWSLTFTFPSTSETLSSGWNATWTGTGQNIEATSLSWNANL
AANGGNSASIGFVGNNTGAYPSPAAISLNGTVCSTTYSS
Download sequence
Identical sequences C7QJR5
WP_015792882.1.73754 479433.Caci_4289 gi|256393430|ref|YP_003114994.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]