SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256393569|ref|YP_003115133.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256393569|ref|YP_003115133.1|
Domain Number 1 Region: 86-344
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.17e-22
Family Type II chitinase 0.081
Further Details:      
 
Weak hits

Sequence:  gi|256393569|ref|YP_003115133.1|
Domain Number - Region: 441-537
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0168
Family Fibronectin type III 0.0089
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256393569|ref|YP_003115133.1|
Sequence length 540
Comment hypothetical protein Caci_4428 [Catenulispora acidiphila DSM 44928]
Sequence
MTRVPSRRSFLATSGGLTAALAGGAMLIGSSPAAAAAPAGNPYPAPCAGDPAHPKRQLRG
AWIASVSNINWPSAPGLTAEQQQTELTGLLDAVVRMRMNAVYLQIRPAADALYASPYEPW
SQYLTGTQGQDPGYDPLAFAVAEAHKRNLELHAWMNPYRVSTQPDPSRLVPTHPARVHPD
WCVEYSGELYYNPGVPAVLDFDVQVITDVATRYDIDGIHFDDYFYPYPVGTADFPDDAAY
AAYGADFPDKASWRRANVDKLVSTLQRELRAVKPWIKWGISPFGIWRNQATDPLGSATNG
LQSYDALSADTRGWIQKGWLDYVAPQLYWNIGFPVAAYDVLVDWWSKAVDGTGTQLLIGQ
TVSKIGTPTPPAWLDPNEMPNHLILNRRYPEVAGDIFFNITKLLTDPLGFQTRLIDDLYE
YPALVPEMFRHSGPAPERTALTEAQPTSTGTRLRWLHLGRPHGVEAAYYAVYRFDGRPPQ
PACDFTDAKNLLGTARAVPDLFNGWTDTSATSGKQYTYYVTALDRSHHESAPSNPQVVGR
Download sequence
Identical sequences C7PW44
gi|256393569|ref|YP_003115133.1| 479433.Caci_4428 WP_015793021.1.73754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]