SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256393823|ref|YP_003115387.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256393823|ref|YP_003115387.1|
Domain Number 1 Region: 55-418
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.47e-65
Family Amylase, catalytic domain 0.000000641
Further Details:      
 
Domain Number 2 Region: 641-737
Classification Level Classification E-value
Superfamily Starch-binding domain-like 4.66e-33
Family Starch-binding domain 0.00014
Further Details:      
 
Domain Number 3 Region: 422-510
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.08e-27
Family alpha-Amylases, C-terminal beta-sheet domain 0.00023
Further Details:      
 
Domain Number 4 Region: 561-637
Classification Level Classification E-value
Superfamily Starch-binding domain-like 4.17e-22
Family Starch-binding domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256393823|ref|YP_003115387.1|
Sequence length 738
Comment alpha amylase [Catenulispora acidiphila DSM 44928]
Sequence
MSSSPRTRPRGRSSGLVALVAAGALALGAIAFSTSFNTAFGAPSGSAAAAAADAASNDVI
ANLFEWNWPSVATECTTVLGPKGYGAVQVAPPQDSIRLAGSTHSWWDVYQPVGYDLNSRM
GTEAQFASMVSACHAAGVKVYADTVINHTAGANQTSTDSYGGDSFNPATYTYGSMGYTKS
DFHFDPPCPNSDLSIQDWNSVAQVQECQLLSLSDLYTEQDSVRSTLAAYLNKMEAYGVDG
FRVDSAKHIAQADMAAILSKVNNTAAGVRPYVMQEVYPGSSGQLAPAAFEGNGNVLGFDY
AYGIRSAFLGSITNLRTFGQGFEPSGSDAVMVANHDLERNGTSLSYKDGAAYTLATEFEL
AYGWGSTPSVYSGFDFSNSDQSPPADANGFVTNTVCGTGAWECLDRNQGVANLVGFHNAT
RGQAVGNWWTDNNNAIAFSRGSAGWISVNNEGSTVSSSYQTGLPAGTYCDLVHGNFANGS
CTGPTVVVSASGTATVSTAAKDAVAIDVNAVVGSSGPPSSSSSAPSTSPSTSPSTSPSSS
APPAGQVAETFAVTGAPSTAPIYLVGSLSALGSWAPASAIPLTQHGSQWSGTVTLPASTA
FQYKYIAKDAGGNVTWEQDPNHSATTGTSGATLTDTWHGASSAVSATFSVNATTWVGQNV
YVVGSIPALGSWNPASAIALSSAAYPVWRGTVTLPPNTAVEYKYIKKDPDGTVEWESGAN
RTYTSPASGAVTLSDSWK
Download sequence
Identical sequences C7PZN1
479433.Caci_4685 WP_015793275.1.73754 gi|256393823|ref|YP_003115387.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]