SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256393829|ref|YP_003115393.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256393829|ref|YP_003115393.1|
Domain Number 1 Region: 316-407
Classification Level Classification E-value
Superfamily Fibronectin type III 1.12e-16
Family Fibronectin type III 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256393829|ref|YP_003115393.1|
Sequence length 544
Comment fibronectin type III domain-containing protein [Catenulispora acidiphila DSM 44928]
Sequence
MHLLRTLRRPPGRLLAGAAALALAGFGLAAPAASASTANAATVSTVSTANAAHVAGIATV
QHVGVPAYFNPSTSYWSQIDQSGSAVGIAIANPNNGPGASFDQSYANAIQAASSAGVRVI
GYVDTGYFGTTGRTTRGGQTTTAAWTTQAEADVDNWYSWYGSYGLSGIFYDDALNDCGTN
NAHVALYQAVGDYVKQHHAGALTADNPGTAADQCYASAADVLVMFEGTYASYTGWTPPAW
ELSSGNPNQFWHLVYDTPTQANMENAVSLSKQRNAGYLYVTNDNLPNPWDTLPTGTYWSD
ELAQTGGAGGGGGDSTPPTAPSGLRAGSVSATGVTLTWSASTDNVGVAAYDVYSGSSVVA
TVSGSSTTATVSNLSPGTAYTFAVKARDAAGNISSASTSVSVTTSSGGGGGSCTPVAGSG
NITNFSACMTATTETFQATFTTAVSLHHVFIDSDNNQGTGFQLPSPSSTPLGADYMIENN
ILYRSLSHGWSWTPVSGVSPNMTHNGNVYSWSIPLSALGTSATTQRAVFNGNTFYTAPIT
FSRG
Download sequence
Identical sequences C7PZN7
gi|256393829|ref|YP_003115393.1| WP_015793281.1.73754 479433.Caci_4691

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]