SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256394018|ref|YP_003115582.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256394018|ref|YP_003115582.1|
Domain Number 1 Region: 25-445
Classification Level Classification E-value
Superfamily Glycosyl hydrolases family 6, cellulases 1.57e-88
Family Glycosyl hydrolases family 6, cellulases 0.00000276
Further Details:      
 
Domain Number 2 Region: 642-739
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 1.74e-29
Family Cellulose-binding domain family II 0.00021
Further Details:      
 
Domain Number 3 Region: 454-637
Classification Level Classification E-value
Superfamily Fibronectin type III 1.27e-26
Family Fibronectin type III 0.0000844
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256394018|ref|YP_003115582.1|
Sequence length 743
Comment glycoside hydrolase family protein [Catenulispora acidiphila DSM 44928]
Sequence
MPWWGVQAAQATSVAPAAAAAAHAANPFVGSSPYLNPDYVSEVQSQASADGSSAEAKVGA
YQTAIWMDHIGAIAGDSSHLGLKAQLDKAETQAAGTTSPVEVEVVVYDLPGRDCAALASN
GEIPATDAGLTQYESQYIDPIVAIEGASGYSNLRIVNFVEPDSLPNAVTNQSKSACAAAT
PYYEKGIAYALGKLHGIGSQIYNYLDIGHSGWLGWPNNMTGAGPEYAKVVQAATGGYATV
DGFVSDTANTTPSDEPFLPNSNLTVGGQPLKSANFYQYNPYFDEHSYDEAMYSEFVSSGF
PSSVGMIIDTSRNGWGGTSRPTSLNSSPTDVNSYVSANKVDLRPFRGDWCNVNGAGIGAR
PQANPYGSGDHVIADVWIKPPGESDGDYPSSSHSHGDPHCDPAGTQTDGNGGTYPTDAIP
GYDVPAGQWFAFQFKQLVQNAYPALGGTTGGDTTPPSAPSGLTVASKTSSSVSLTWTAST
DNVGVTGYDIYRGTTLAGTSATPSFTDTGLTASTQYSYTVKAFDAAGNLSSASSAVTATT
SGGSTGGDTTPPSTPTNVTASGVTSTGATLSWSASTDNVGVAGYHVYRSGTLVGTTTTTS
FADTGLTASTQYSYTVVAYDAAGNLSPASAAVSVTTSGGSTGGSGCAATYQIGSDWGSGF
TANVTVTNTGTAPTKSWKVTWTWAGNQQVTSMWNAASQQSGHSETATSMAYNGAIAAGGN
TTFGFQGTYSGSNANPTLTCSAS
Download sequence
Identical sequences C7Q1L2
WP_015793470.1.73754 gi|256394018|ref|YP_003115582.1| 479433.Caci_4881

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]