SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256394094|ref|YP_003115658.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256394094|ref|YP_003115658.1|
Domain Number 1 Region: 56-394
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.95e-43
Family beta-glycanases 0.0015
Further Details:      
 
Domain Number 2 Region: 583-687
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 8.37e-34
Family Cellulose-binding domain family II 0.0000945
Further Details:      
 
Domain Number 3 Region: 388-484
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0000000000206
Family Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 0.0049
Further Details:      
 
Domain Number 4 Region: 496-579
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000251
Family Cadherin 0.055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256394094|ref|YP_003115658.1|
Sequence length 688
Comment cellulose-binding family II protein [Catenulispora acidiphila DSM 44928]
Sequence
MSVHVLTRRTDRRKIVSLAASLSVVAACTLAVVVPSGAAYAADTATINGATTYQTIAGFG
ASEAFGEAAAVMNASSSVQQQALADLYSPTTGAGLTILRNEIGATSGNTIEPTNPGGPGA
TPNYLPLSQINQDMGQLWFAQQIKARYNVTNVYADAWSAPGFMKTNNSVSGGGQVCGSAG
ASCSSGDWRQAYSNYLVQYARDYAAAGVPLTYLGPSNEPDYSTNYDSMSMSPAQMASVVD
VLGPTLRSSGLATQVTCCAATGWPKAGQYAAAIEADPTALAAVGMVGGHGYSGAPTSPLP
GWTKQSWETEWSTFEGFSSAWDDGSDASGMAWAQHINQGLTGANLNAFLYWWGSTTPSEN
GDNEGLLEINGSSVIPTGRLWAFANYSRYIHPGAVRIGASSSNGAVNLSAYKNTDGSLAI
VALNTGSGSDALTYSLANTGVANGATVTPYLTNNANQVAAQGTTTVAGGAFTATVPGRSL
VTYVIPAGVVSGNTVTVTNPGSQTGKVGTAISGLQIQGTDSGSGQTLTYSASGLPAGLSI
SSSGLITGTPTTAGSSTVAVTATDSTGASGSAGFTWTVTGGTTTGTCHVAYTRTNEWPGG
FTANVTITNTGTAAINGWTVGWSFPGDQKITNAWSATATQSGAAVSATNAAYNSTIAPGA
NTSFGFQGTFTANDTSPSSFTVNGAACS
Download sequence
Identical sequences C7Q381
gi|256394094|ref|YP_003115658.1| 479433.Caci_4957 WP_015793546.1.73754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]