SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256394099|ref|YP_003115663.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256394099|ref|YP_003115663.1|
Domain Number 1 Region: 58-368
Classification Level Classification E-value
Superfamily (Trans)glycosidases 2.11e-110
Family beta-glycanases 0.0000000685
Further Details:      
 
Domain Number 2 Region: 673-777
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 5.51e-33
Family Cellulose-binding domain family II 0.00011
Further Details:      
 
Domain Number 3 Region: 585-668
Classification Level Classification E-value
Superfamily Cadherin-like 0.000000022
Family Cadherin 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256394099|ref|YP_003115663.1|
Sequence length 778
Comment glycoside hydrolase family protein [Catenulispora acidiphila DSM 44928]
Sequence
MDIDTGAPHRANPPRPGRAGSPDRRGLRGALAVVTVAAITAAAGALLLGGQASAAPTTLR
AGAEADSRYFGVAVGQQDLGNGTASNVAGSQFDMVTPQNEMKWDTVEPNNGQFNFSPGDA
IVNFATSHNERVRGHNLVWHSQLPGWMSSLSGSQAKSAMEAHITGEVSHFKGKIYAWDVV
NEPFNDDGSFRQDVFYNAFGGGAQYIGDAIRTAHAADPAAKLYINDYNIEGQGAKSDAMY
NLAKTLVAQGVPLGGIGFESHFIVGQVPSSLQANMQRFAALGLDVAITELDDRMPTPASS
GNLQQQATDDANIVKACLAIAQCPGITQWNISDADSWIPGTFPGYGAATLFDNNYQPKSA
FNSVMTALSSGSVPPTSPTSGSSSPPSTYANLAASFDNVGISADGNTAAGNLDGGGSSFS
QTALTNAHAGPGAQVTSSGVTFTMPAAAAGSNDNTVPQNQIITMSGTGTLGFLLTSSYGP
ATGTGTITYTDGSTQSYTLSSADWWATTPAGGSALAVSSTYQNRPGNTTATQSGNIFSQA
VTLTAGKTLASVQLPAGSPVASGTPALHIFAISTTAGTSGGNTVTVTGPGNQSGTVGTAI
SAVQIQATDSGTAQTLTYTATGLPAGLSISSTGLITGTPTTAGSSTTTITATDATGAAGS
ATFTWTVTGGGTTTGVCHVTYAKTAEWAGGFTANVTIANTGTAAINGWTLAFTFPGDQKI
TNAWNGATSQSGEAVTATSAAYNASIAPGATTSFGFQGTFTSNDTAPTTFTVNGAACS
Download sequence
Identical sequences C7Q386
479433.Caci_4962 gi|256394099|ref|YP_003115663.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]