SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256394179|ref|YP_003115743.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256394179|ref|YP_003115743.1|
Domain Number 1 Region: 528-849
Classification Level Classification E-value
Superfamily (Trans)glycosidases 5.9e-73
Family NagZ-like 0.0000577
Further Details:      
 
Domain Number 2 Region: 851-1085
Classification Level Classification E-value
Superfamily Beta-D-glucan exohydrolase, C-terminal domain 1.11e-47
Family Beta-D-glucan exohydrolase, C-terminal domain 0.0021
Further Details:      
 
Domain Number 3 Region: 381-509
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 7.01e-28
Family Galactose-binding domain 0.048
Further Details:      
 
Domain Number 4 Region: 37-187
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 1.7e-21
Family Family 6 carbohydrate binding module, CBM6 0.00053
Further Details:      
 
Domain Number 5 Region: 251-359
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 4.82e-19
Family Family 6 carbohydrate binding module, CBM6 0.00055
Further Details:      
 
Domain Number 6 Region: 1251-1316
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000314
Family Cadherin 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256394179|ref|YP_003115743.1|
Sequence length 1321
Comment glycoside hydrolase family 3 [Catenulispora acidiphila DSM 44928]
Sequence
MRTLLAAGALFAASLAGLPSPANAAASAPFGGTAAAVPGLIQAANYDTGGQGVAYNTVAG
NGSANSYRADGIDLETTADTSGTTPAGGAYDIGWTNAGQWFNYTVNVATAGTYSVAFRLS
SPYGLTDALHIANASGTNLTGSVAVPNTGGYETWTTVTASLVLPAGTQTLTVKQDSNGWN
FHNMAFTLTSSGGGGGGGTDKPFGGTPAPVPGTVQIANYDTGGAGVAYNVTGTNGSANGY
RTDGVNLENTADTQDTTPPGGAYDMGWTNAGQWFHYTVQVATSGIYTVSFRVAAPAAIAD
ALHVADSTGANLSGAVAVPATGGYQTWSTVTASVTLAAGAQTLTVAQDAAGWNMHFLSFA
QGSSGGGGGGGGGGGGGKYCGYQDLALAQPTTASSTYSATGNLAPAATDGNPGSRWESAY
SDPQWLEVDLGAQTSICAAALSWEAAYASAFQIQTSTDNATWNTVYSTTTATGGSESFTF
SATARYIRVNATKRATQWGDSILEFDVYGLTDVPPLSGGNGTGGNGVCPWVNSTASVASR
VQQVLNTMNQSEEFTLLSGDGGSSYIGQVAGIPNLCIKPMNMQDGPTGVGDGTGGVTAYP
DGESAAATWDPALIQQEGTAMGAEFAGKGVNVSLGPTTNLVRDPRWGRTYETYGEDPFLA
GQITSSQVKGLQSQGVQAMVKHVAAYDQETYPNGGNNETVSNQALQELYLAPFESTIAQS
APASFMCSYAVVNGNASCQNSYMQIKGLDDAANFGGYITSDWGGDYNNVASVVGGMDIGM
PFPGSIPTDLANAVSNGTLSQYGVNAAVSRILTQMFAFGLFDNPASGSLANTVTSAAHQQ
TALQLGEEGTVLLKNNGLLPLNPNPTTAKSIAVIGTDGGAGVEIAGGGSGTVTSANTIWP
ITGIQNAVGPNMKVTYTQGNDNGTANIPQAVAAAKAATYAVIYVNAPEGEESDLQTLNLS
ATDETMINNVAAANPNTIVVINSGSPVVMPWLNNVAGVFENWYGGGETGAAVAALIFGTA
NPSGKLPVTFPASLSQVPAQTTAQWPGTPTGPIYSEGVKIGYRWYQSQNITPAFPFGYGL
SYTKFSFSNLAVGGFNSNGQATVTATVTNTGSVAGAEVAQMYVGDPAASQDPPNQLAGFQ
RVMLNPGQSAQVSFPLTIHNLAAWSPTDNQWEAQAGSYAIRVGDASNNLPLTGSTSLANT
LTGQVAAGSSYAGISTANTAVSANVTPNSGVPGSETVGVANPFGYSSPKGTGVSFQMQGV
DSNASQTLTYTASGLPPGISISGNGTFSGSGNTLGTYTVTVTAKDGAGVTGTATFVWSIV
Q
Download sequence
Identical sequences C7Q4V4
gi|256394179|ref|YP_003115743.1| 479433.Caci_5042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]