SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256394214|ref|YP_003115778.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256394214|ref|YP_003115778.1|
Domain Number 1 Region: 59-261
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.000000000024
Family SGL-like 0.037
Further Details:      
 
Weak hits

Sequence:  gi|256394214|ref|YP_003115778.1|
Domain Number - Region: 252-366
Classification Level Classification E-value
Superfamily Calcium-dependent phosphotriesterase 0.00654
Family SGL-like 0.046
Further Details:      
 
Domain Number - Region: 741-831
Classification Level Classification E-value
Superfamily Cadherin-like 0.0129
Family Cadherin 0.051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256394214|ref|YP_003115778.1|
Sequence length 1009
Comment hypothetical protein Caci_5077 [Catenulispora acidiphila DSM 44928]
Sequence
MRAPKRWRNRVLHVVMCAALSLAGTAASTSAARADPAPLPTVADLGVFYASYDYSSASGG
GASGIARGADGNFWAAVTQNAQTYIIVFSPSSHTIVARYPVDGGVSTMVAGPDGEVWFAE
DGVGTASTQSAIAEIDTSGTITTHLLPASDGPRVGSLTFDASGDAWFLADAGADNVRGYV
GHLASGGSLTQFAMPYHYGAASADHELAIAPDGSAWFIGSIAGVVQIGSLTPAGAFAYHG
LPAGAANTQDQIVLGPDGRLWFDAGFVPHSDFIYEVGEIDPATGAQTLYTMPSDFAGGFL
SVGADGIIYDAGTVGPLHHQSGTAFDTAVMAISPTDGRATEFTGPDTFSPQDIATDAAGN
LWMNQGAMFAEVSLTAAHSTAMTVAPDVNPAYYGQPGGVTVTLTPTEPGSPAPTGTVTFA
ARQFASVTEPVVNGTATLPITDLPLGLTSLYATYSGDADYGPESSDLLQETVNGSPTTLT
LASELNPSRTDQSVHVTATVAMAGGSAPKCCSVQFTVDSGAPQAVALTGSTAALDLSSLS
VGTHTIKADFVNQPGYGPSTSTLTQTVTAADACPCTVFPDSATPVVPDTGDGSAVELGVK
MHVSTAGNVTGIRFYKSAANAGPHTGSLWAANGALLATGTFTGESASGWQTLTFANPVPV
RPGATYTASYYAPHGHYSADGGFFTTGGAGSGLITALADGASGGNGVYAYGPGSQFPSDS
YNASNYWVDALFDTTGVPTGPPTVTGTTPVAAATGVADTIAPTATFSAALDPTSLAYTLT
DAAGVTVPAVASYDAATRTATLTPTTQLPSGTVFTASITATDAWGHAMTQPTTWSFTTGT
TPPAYNCPCTLFAPGDAPAVTNSGDYNSVELGVRFTSAVNGTVTGIQFYKGSLNTGTHTG
SLWTTDGTQLATGTFTNETASGWQTLTFTTPIAITAGTTYVASYHAPNGNYSYTANYLDY
PHTAYPLTAPTGSVPPGNGVFAYESSASYPVEFSDGNNYWVSLLFAPGS
Download sequence
Identical sequences C7Q4Y9
479433.Caci_5077 WP_015793666.1.73754 gi|256394214|ref|YP_003115778.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]