SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256394784|ref|YP_003116348.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256394784|ref|YP_003116348.1|
Domain Number 1 Region: 10-268
Classification Level Classification E-value
Superfamily Cgl1923-like 1.2e-82
Family Cgl1923-like 0.00000193
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256394784|ref|YP_003116348.1|
Sequence length 307
Comment hypothetical protein Caci_5648 [Catenulispora acidiphila DSM 44928]
Sequence
MVARKDPKALYELAPGTPGMAGVVLLHQMEGFMDAGGAGRLASEHLLDQFDHRLVASFDV
DRLIDYRSRRPTMTFDKDHYDHYEDPALDVHLLTDGEGKRFLLLDGLEPDREWELFAQAV
RSLIEHFDVSITVGMHGIPMGIPHTRPLGITAHATNPGLVDTADQPVLDRLQVPSSAASL
LEYRLGEWGHDAAGFAVHVPHYLASSLYPQAAIRLLRAVSEATGLILPDVELRDAARRAS
EDIERQVQESSEVEDVVRALERQYDAFNVTDRKNLLSDNDGRMPTADELAEEFERFLADQ
DGPPPSP
Download sequence
Identical sequences C7QC59
WP_015794236.1.73754 gi|256394784|ref|YP_003116348.1| 479433.Caci_5648

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]