SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256394792|ref|YP_003116356.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256394792|ref|YP_003116356.1|
Domain Number 1 Region: 697-822
Classification Level Classification E-value
Superfamily Ricin B-like lectins 8.54e-32
Family Ricin B-like 0.00072
Further Details:      
 
Domain Number 2 Region: 441-576
Classification Level Classification E-value
Superfamily Ricin B-like lectins 0.0000000000000156
Family Ricin B-like 0.03
Further Details:      
 
Domain Number 3 Region: 604-685
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000133
Family Cadherin 0.072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256394792|ref|YP_003116356.1|
Sequence length 824
Comment ricin B lectin [Catenulispora acidiphila DSM 44928]
Sequence
MRLRKTLLAALAAGALACVGAVAPGSASAAPPSATYTVSIGSNGTFSAQSDSPAGAFVDR
DGTFYFQESYSGYGSSDGRVWQFYSGSDFDSASLNSTISNSVNPANSQDANNNTTWRCDN
SPTGLASTSAGSGSGYTQPNFCDLIGMWVDPDTGNWIGLVHNEFTPQPFGDGLHYDAIDY
AVSTDRGMTWKITGHAITSPYSTKRNDTTAFPNQTYNYGDGDQRLYVDTASGYFYVYYGS
RVVPKGGVGGSTGGLAHVARAPISGKMATGTWQKWYNGAWSQPGVGGLESNMVPVDSTNP
TGYTAPAHDYNPANTGTVDQQVAAGQLPAKSPLFIMNITYDAYLGLYVGTPEVVSGTQPQ
QYYVTDDLSTQKWYYVGNSGSAYTQGSWYRWFADSGDKWNPTIVGKSFRAYCSVACVNNA
GSLYTNETIDSTAPAQPPVDTTKTYTIGTSAGRVLAQVSGGSSVTSDAAASGSALEAWQF
TANGDGSYRITNASTGQALGVTAATAGRAWGAAPTATALSGGTGSVGQQWWIVPVTGQSG
SYKLVNRYSGLVLALSSNTSRLAETTPTRAWTDTSGTGIGGGRTAAEQTLAFTPATSSGT
ETVTVANPGTQTTTVSTAVSLQITASDSKNKALTYSATGLPAGLSISSAGKISGTPSATG
SASVTVTASSGTATGSTTFTWTVGPAAANLTGTHTLTASGQALDDPNHSTTTGTQLVTWS
PNGGSNQNWVFTQQSDGSYQIQNQQSQLCMDDNGGFTTAGTSVIQWTCTGSANQHWTATR
LAGGAYTLTNVHSGLLVTTASTANGALVTQETNSGSALQQWTVG
Download sequence
Identical sequences C7QC67
WP_015794244.1.73754 gi|256394792|ref|YP_003116356.1| 479433.Caci_5656

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]