SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256394988|ref|YP_003116552.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256394988|ref|YP_003116552.1|
Domain Number 1 Region: 56-460
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.18e-86
Family Amylase, catalytic domain 0.0000000235
Further Details:      
 
Domain Number 2 Region: 642-742
Classification Level Classification E-value
Superfamily Starch-binding domain-like 1.01e-25
Family Starch-binding domain 0.0000307
Further Details:      
 
Domain Number 3 Region: 463-553
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 1.02e-21
Family alpha-Amylases, C-terminal beta-sheet domain 0.0000989
Further Details:      
 
Domain Number 4 Region: 559-639
Classification Level Classification E-value
Superfamily E set domains 0.00000000000798
Family E-set domains of sugar-utilizing enzymes 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256394988|ref|YP_003116552.1|
Sequence length 742
Comment alpha amylase [Catenulispora acidiphila DSM 44928]
Sequence
MQRRRRLTLVGTAVSLAAATAVTAAAAPSSAAPARSAAALNAAALSSTPVSTGDMTNDVI
YQLLTDRFYDGNTGNDNPSSSPNLNDSSHNNWQEYWGGDFAGVSAKMQYLSDLGVGAIWI
SPPVENVNVPVPDSTTGATTAGYHGYWGMDFYTPEPHFGQWADFDAMVAAAHAKGIKVIM
DWAVNDSNPEDTSNPNYGAGGALKQNGTTLSTYDNDPNGYFHHNGGVGDYSNLYDVEYQN
LFNLADLAQENPAVTNYVQGAVDTWLSHGVDGIRMDAVKHMPGGWLKGYVDHIENSHSVF
MYGEWADPSSAPLWSDEVKFANTDGQSLENFDLNTAVRDVFASNANMSELDSELSRQQSS
INWSNDLVDFVDSQDENRFLSINNNTTLLDQATVVNMTVPGIPSVYYGDEQYLHNDTTNS
FGQVGGDPYNRAQMTSFAETSRNFAVTQKLAALRKANPALRYGSSTQRWLNNDVYVYERK
FYNNTVLVAVNKSKTANYALTGLNTSLPAGSYNDVLSGALGGGTLTVSTGTGGNNPTGAY
TLNAGQAAVWSYAAPTASTPEVGNIGPTIGHSGDVVAVTGTNFGTTAGTATVGGTAAPVK
YWSNTEVDLAIPAGATAGLDQVVLTSSAGTASNGIAYHVESGTQVPVTFTVTGTSTSPGD
EIYLSGNDDELGNWSTDTATAIGPLLDPNYPTWFSLASVPAGATVQFKFFIKHTDGTVTW
EGGSNHTYTVPASGTGTVTVAW
Download sequence
Identical sequences C7QDT7
WP_015794440.1.73754 479433.Caci_5853 gi|256394988|ref|YP_003116552.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]