SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256395539|ref|YP_003117103.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256395539|ref|YP_003117103.1|
Domain Number 1 Region: 1168-1367
Classification Level Classification E-value
Superfamily SGNH hydrolase 0.000000238
Family TAP-like 0.067
Further Details:      
 
Weak hits

Sequence:  gi|256395539|ref|YP_003117103.1|
Domain Number - Region: 558-630
Classification Level Classification E-value
Superfamily Fibronectin type III 0.098
Family Fibronectin type III 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256395539|ref|YP_003117103.1|
Sequence length 1375
Comment hypothetical protein Caci_6408 [Catenulispora acidiphila DSM 44928]
Sequence
MPTGANRRRSIRPLLLAAVLALAWGSAAGPLARPAHAVTAPDSSTDPAAAIDPVSDQDLV
ADQAMAAASSQAAASGTPQAVTALFSPTEQVFANPGGDYTMTASQLPTQVLKAGSWVPTD
ATLAPDGSGGLAPKASYDALRLSGGGTTALAALTAQGMTLTMGWPSALPTPAVSGATATY
PDVLPGVDLQVSADELGDVSDVLVVKDAAAAADPGLASIAFPVTAPGGTVSADADGNLTV
AQADGQARYSAAAPRMWDSATGTDPIVSSPDGPGTAAATAAVGVAVGANGTLTVTPSQSM
LTSAATAYPLYVSGPQWHAHWANGPEQAFDEVQQGCPGTSNFDSTTYDGDGLGTGDNTYW
DCTGVERAYYRFGLPLSQLAGAQIISATLKTTVSFAASKGSNSDTLNVYSSCGIDGSTTW
KHQPCRDTTANPNSPNPLATASFTTTNQHPGLGVGFNVASGLNAALAHHWGTWTLGVTNA
DESDGSDFVRLAKNPNISIEYDHAPRQPWGLTAIDGSANTACVTTAPYPWMGKTASVTPP
KLSAYVGDVDGDQVQAGFHYWIEGTSTGGTVYSTVASGQLAQAPEPQSFVSALATGQTVD
WQVRAYDGHAYGPWSPVCHYKIDKTAPDEPGVTSAYYPQLVSGQTPVAAGTPGTFTIQAG
VGAATSMTFVYRLDAAPPAVNAPSNEKIAATKVAAGSGFVYSAAITMAAPSPGPHNLYVY
SVDQAGNASGEYIYQFLANPDVHVTCADLSSCFNNTLTSTNANPAAGNADGGSASISATD
LAAAGWPTAGGTVTVDGAPIKVPAYGNGAKDNALAKGQTIDLPAGTRGSALVILATGTEA
NAVTPDVDTASVPANVAAPILPGGAPMVARYDATHHVAVYPSGTVAYGTGPTSDYSVSVP
DWAAGPAAAAVVTLPHTNTPSGQLARPVKLYAFAIPLSPDRTLSSVSLPDISGAVNENGQ
LTDTPAIHILGIGVRPVRGAGLPTGAAVGSAWTTAWSSPDEGVYSTAAGHWAAKQTIRTS
LTPAVSGSGIRVRLSNEGNTTGLSIAGATLAQQAAAGSPTSSGTPVPLTFGGARAVQIPA
GGQVWSDPLPATVTAGQPVLLSESIGATVTSVPGHTWSSGSTTTWLTAADGVDHSGDTAA
AAFTATGTKTGHFTNVLAGLDVVTASAVPTVAVLGDNVVNPGGTGMKPVSGSPQLADAMR
AAAGGASVVDAGLPDNHVVGDSTAAAGGPALLTRIDRDVLDETGIGTAVLDEGLVDVLGG
ARSTSTTNAYGVLQNLLTSFGVSAIYATPTPCGGYSACTSTVEAERQNLISYIGNSTYSV
VSPYEADFSSAIGGTANPQALLAADDAGDHVNLTPAAYTTLAATVDAAWLKPNSR
Download sequence
Identical sequences C7PWI2
479433.Caci_6408 WP_015794991.1.73754 gi|256395539|ref|YP_003117103.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]