SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256395679|ref|YP_003117243.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256395679|ref|YP_003117243.1|
Domain Number 1 Region: 47-331
Classification Level Classification E-value
Superfamily Glycosyl hydrolases family 6, cellulases 2.22e-86
Family Glycosyl hydrolases family 6, cellulases 0.0000001
Further Details:      
 
Domain Number 2 Region: 384-486
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 2.72e-28
Family Cellulose-binding domain family II 0.0001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256395679|ref|YP_003117243.1|
Sequence length 487
Comment glycoside hydrolase family protein [Catenulispora acidiphila DSM 44928]
Sequence
MFPDFSSPGSARRRGFSAVAATVAAVAGLVVATQLGGVAMAGTIASGTQFYADPNSQVVK
WDAANPGDAREPAIASQIASVSQGIWFSNYRPSTVQSDVSAVTTAAAAAGKTPVLVVYEI
PNRDCGGASAGGAPDISSYENYIQSFANGLGSHQVIVILEPDSLALQTCLSSQQATDRDN
AIAFAGAHLKSADPAAKVYLDAGHSSWNSPSAQAAALNAAGVKTSSDGIFSNVSNFQTTA
SEVSYDKQVLAALGSPSNLHIVVDTSRNGNGPAGSAWCDPSGRALGQAPTANTGDAAVDA
FLWIKPPGEADGCADAAGTFDPALAYALITNGGGPPPTSPSSTPSTTPSTTPSTTPSTTP
STTPSTTPSTPPSTTPSSPPSSSPAGCQVTYTRTNEWAGGFTANVSITSSKALSSWTVGF
TYGGDQQITNSWNGNHTQSGRNVTLTSLSYNGSIGAGQTLTGVGVQGTWTSSDAAPSAFT
LNGVACH
Download sequence
Identical sequences C7PYB2
479433.Caci_6555 WP_015795131.1.73754 gi|256395679|ref|YP_003117243.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]