SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256395763|ref|YP_003117327.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256395763|ref|YP_003117327.1|
Domain Number 1 Region: 66-369
Classification Level Classification E-value
Superfamily (Trans)glycosidases 4.74e-38
Family beta-glycanases 0.008
Further Details:      
 
Domain Number 2 Region: 621-725
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 1.81e-31
Family Cellulose-binding domain family II 0.000082
Further Details:      
 
Domain Number 3 Region: 523-622
Classification Level Classification E-value
Superfamily Fibronectin type III 0.00000000000000552
Family Fibronectin type III 0.00044
Further Details:      
 
Weak hits

Sequence:  gi|256395763|ref|YP_003117327.1|
Domain Number - Region: 413-482
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.0791
Family Composite domain of glycosyl hydrolase families 5, 30, 39 and 51 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256395763|ref|YP_003117327.1|
Sequence length 727
Comment cellulose-binding family II protein [Catenulispora acidiphila DSM 44928]
Sequence
MRRRQSRFPRSWTAVAAAALFVGSAAVPLAASAGPASAGPAAAAASTATVGVNAGQTLAT
VPSTAIGTNGSVYDAALTDAAVPGLLKNAGTGLIRFPGGTSSDTYNWKTNTDVKSGLAQS
VDFDQYATLLSQTGAQGMVTVDYGTGDAAGASQSPAETGAQFAADWVRYANVTHHDGIKY
WEIGNEIYGNGTYGANWEPDDHCAAGTNPTNCGPAVYAQNVKAYIAAMKAVDPTIVVGVV
LTAPGNWPDGVTNGGSPQTWNQTVMSALNGQIGFADVHWYPQNPGNESDSTLLSAPSQIP
TMVSTLRSQLGQWEGSSTVPIMITETNSVSSNPGKQILSVVNALYLTQDYLGWIQNGVAS
VDWWQIHNGIVTGGNTSSSLYGTATYGDYGMLSDGSCGLVNGSRVCEPAADTPFPAYYGT
QLLSQFIHPGDALVSASSSQSLLKSYAVKAADGSLRVLLVNDDPATSYTVGLNYTGFTPA
SGAPSVATLAPPGTGITTAASGSASSQTIAPYSAAVVTLKPGTTVTPPTTPGTPTASNVT
STGATLSWSASTSSTGLAGYDVVAVNGSTETVVASPTTNSATLTGLTPSTAYTFAVYARD
TAGNRSARSGTLAVTTSAGSTGASCKVTYAPNVWGGGLTANVTVANTGTAAWSSWTVGFA
FPGDEKVTNGWNATVTQSGANVTATNMSYNGTIAPGATTSFGFQGTWSASSASPTAFTVN
GSACTTG
Download sequence
Identical sequences C7PZZ3
gi|256395763|ref|YP_003117327.1| 479433.Caci_6640

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]