SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256395805|ref|YP_003117369.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256395805|ref|YP_003117369.1|
Domain Number 1 Region: 48-458
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 1.44e-76
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.00000064
Further Details:      
 
Domain Number 2 Region: 472-784
Classification Level Classification E-value
Superfamily Oligoxyloglucan reducing end-specific cellobiohydrolase 1.7e-38
Family Oligoxyloglucan reducing end-specific cellobiohydrolase 0.00000496
Further Details:      
 
Domain Number 3 Region: 830-934
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 6.28e-31
Family Cellulose-binding domain family II 0.0000923
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256395805|ref|YP_003117369.1|
Sequence length 935
Comment cellulose-binding family II protein [Catenulispora acidiphila DSM 44928]
Sequence
MRRSWKNAVSAVLGAVLAVAGLGVVSVSLSGSTAAAASAASAASGSGYTWQNVPIVGGGF
VPDVVFNTGAKNVAYARTDIGGMYRWNQSSSSWTPLLDWVGFTNWNEQGVVSVAADPVQT
NRVYAAVGMYTNSWDPNNGAILRSTDQGSTWSATPLPFKLGGNMPGRGMGERLMVDPNDD
AVLYMGMPSGHGLWKSTDYGVTWAQVTAFPNVGNYVQDSTDTTGYLSDNQGVAWVAFDKA
SGTTGAAGTPTKTIFVGVADVQNTVYESTNGGATWSRVAGQPTGFLAHKGLVDPTGAYLY
ITTSDKGGPYDGASGDVWKYAIASGTWTQISPVKSSDTSNDFYGYSGLTIDQQHPNTIMV
TGYSSWWPDTFIYRSTDGGATWTNAWSYNGYPTRVDKYTLDVSASPWLSWGNYPSPPEET
PKLGWMSEGLAIDPFNSDRMMFGTGATLYGTTNLTAWDSSTAKVKLSVMAQGIEETAVTD
LVSPPSGAPLLSALGDVDGFRHTDLTKVPAMMYQSPNWSTSTSIDYAEANPNDVVRVGNG
SSTVNSAAFSSDDGADWYAASSQPSGVTAGGTVAMAADGSAAVWSPTSAAVSYTTTTGSS
WTASTGIPAGAQVRSDRVNPKKFYGFNYATGTFYLSTDGGKTFTASAATNLPSGTGGAYV
HAVPGTEGDLWLAGGSTSGAYGLWHSTDSGATWTKLANVQQADNIGFGAPAPGRTNKALY
TIAEIGGVRGIFRSDDDGSTWTRINDDQHQWGNIGAAITGDPRVYGRVYVGTNGRGIVYG
TMTGTGSSSSSSPSTTPSTTPSTTPSTTPSTTPSTTPSATPSTTPSSSAPAGTCHVTYTK
ASEWGGGFTANITVANTGASPWTAWTVAWTYPGDQKVTNGWNATVTQTGAKVSATNVAYN
GSVASGSSASFGFQGTWTSNDTSPTAFSVNGAACS
Download sequence
Identical sequences C7Q035
WP_015795257.1.73754 gi|256395805|ref|YP_003117369.1| 479433.Caci_6682

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]