SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256395806|ref|YP_003117370.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256395806|ref|YP_003117370.1|
Domain Number 1 Region: 207-632
Classification Level Classification E-value
Superfamily Glycosyl hydrolases family 6, cellulases 1.83e-99
Family Glycosyl hydrolases family 6, cellulases 0.00000199
Further Details:      
 
Domain Number 2 Region: 44-148
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 1.33e-20
Family Cellulose-binding domain family II 0.00027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256395806|ref|YP_003117370.1|
Sequence length 633
Comment cellulose 1,4-beta-cellobiosidase [Catenulispora acidiphila DSM 44928]
Sequence
MGQSSPSATGRARRLTSAFVAAGVTLGVAGGLAALTTTSSNAATAAGCTAVYSTTWDSGS
GFGAQVVITDNGPAWTNWTLSYSYAGNQTLQNGWNGTWNQSGKTVTVTNASYNGAVASGG
TVTPAGNFGYSGTNAAPTSFSVNGMTCSGTTPPPTTPTTTPSTPSTTPTTTPSTTPSTTP
STTPSTTPSTTPSTTPSTGGGGGGHVANPFVGASQYLSPDYAGEVNAQAAADQSSNPALA
ASESKMAGYATAVWMDRIAAITGTGDSVHHGLQWHLDQALSQQKAGTPITFEVVIYDLPG
RDCAALASNGEIPATAAGLTEYESQYIDPISAILADPKYSGIRIVAIVEPDSLPNAVTNQ
SKSACATATPFYESGVEYALNKLHAISNVYNYVDIAHSAWLGWSSNMGPAAQEFAKVARA
TTAGFASVDGFISNTANYTPTTEPFLPNSTLQVGGNPLDSAKFYQYNPYFDEYDYDQAMY
SQLVGQGFSANIGMLIDTSRNGWGGPNRPTALNSSPTTVDTYVAANKVDQRSFRGDWCNQ
NGAGVGSRPTVQPYGASNHIIAYVWIKPPGESDGDYPSASHSHGDPHCDPAGTNTDGNGG
TYSTGSIPGYDVPAGQWFAAEFQQEVENAYPAM
Download sequence
Identical sequences C7Q036
gi|256395806|ref|YP_003117370.1| 479433.Caci_6683 WP_015795258.1.73754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]