SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256395993|ref|YP_003117557.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256395993|ref|YP_003117557.1|
Domain Number 1 Region: 44-367
Classification Level Classification E-value
Superfamily (Trans)glycosidases 3.37e-80
Family NagZ-like 0.00013
Further Details:      
 
Domain Number 2 Region: 369-596
Classification Level Classification E-value
Superfamily Beta-D-glucan exohydrolase, C-terminal domain 4.18e-55
Family Beta-D-glucan exohydrolase, C-terminal domain 0.00095
Further Details:      
 
Domain Number 3 Region: 807-930
Classification Level Classification E-value
Superfamily Ricin B-like lectins 8.91e-37
Family Ricin B-like 0.0002
Further Details:      
 
Domain Number 4 Region: 716-801
Classification Level Classification E-value
Superfamily Cadherin-like 0.00000000138
Family Cadherin 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256395993|ref|YP_003117557.1|
Sequence length 933
Comment glycoside hydrolase family 3 [Catenulispora acidiphila DSM 44928]
Sequence
MRVRPLPLTKSRAFVALTALSLGAAGLLSAELPASAAPAASATCPWVGSNAPVASRVSQL
MAKMSLSQEISMMTGTKGSSFVGETPAIGSLCIPAMNLEDGPAGVADGMTGVTQLPAPVS
AAATWDTGAESAYGKVIGSEEAAKGSTVDLGPTINIVRDPRWGRAFESIGEDPYLNGVLG
AAEIRGVQSTGEMAQVKHLAAYNQETHRNTSSDNVIVDQRTLEEIYLPAFDTSVGSGAAS
SVMCSYSTINGTYACQNPNIMNDVIHKQFGSNAFITSDWGALHTTAGGANAGLDQDMPGD
DGYYGGALQTAVNNGQVSKATIDAAVRRVLTQMFGFGMFDNVSSGSPRATVTSSAHTATA
RQIADQGTVLLKNANNQLPLTSSTKSIAVIGADASTSVRSAGGGSASVKAGSVVSPLAGI
TSRAGSGVTVTYNDGSSSSSAATAAGKANVAVVFVSKSESEGGDLSNIDLASSDNALISA
VAKANPHTVVVLNTGSAVTMPWLSSVSGVFEAWYSGQEDGNAIADLLFGDVDPSGHLPVT
FPTSLSQVPANTAAQWPGANNKVEYSEGLQVGYRHYDATNQTPLFPFGFGLSYTSFSFSN
LTVGSLTKGGSATVTAKVTNTGSRAGSEVAQLYVVDPSSSGEPSKQLQGFGKVTLAAGAS
TTVSFPVTEENLRHWNTGSNAWTTDTGAYGIRVGDSAANIPLSGTLNVTSAQLGQPVTVT
NPGPQATIAGATVSVPVTAKDSTGGQTPAFSATGLPAGLSISASGTITGTPTSAGTTTVD
VTAKDGNGATATTSFVWTVSPSTAGVPTVPYVGQGGKCLDLAADDNTNGAKVEIYTCNNT
SGQSWSHLADGTLRSAGKCMDVKGAGTANGTLVQIYDCNGTGAQVWKSGSNGSLINPASG
KCLDDPKSSTTDGTQLQIWDCNGNSNQSWVPRA
Download sequence
Identical sequences C7Q3F1
gi|256395993|ref|YP_003117557.1| 479433.Caci_6878 WP_015795444.1.73754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]