SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256396080|ref|YP_003117644.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256396080|ref|YP_003117644.1|
Domain Number 1 Region: 899-1004
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 6.56e-32
Family Cellulose-binding domain family II 0.00034
Further Details:      
 
Domain Number 2 Region: 708-900
Classification Level Classification E-value
Superfamily Fibronectin type III 2.6e-31
Family Fibronectin type III 0.00038
Further Details:      
 
Weak hits

Sequence:  gi|256396080|ref|YP_003117644.1|
Domain Number - Region: 242-463
Classification Level Classification E-value
Superfamily (Trans)glycosidases 0.00984
Family Amylase, catalytic domain 0.03
Further Details:      
 
Domain Number - Region: 126-158
Classification Level Classification E-value
Superfamily Fibronectin type III 0.0552
Family Fibronectin type III 0.0071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256396080|ref|YP_003117644.1|
Sequence length 1007
Comment cellulose-binding family II protein [Catenulispora acidiphila DSM 44928]
Sequence
MHIRTRRRIPARDHRPRAVRPSRHRAALAVAALAASVIGWMPGVSSAAPAAASGTSGDPG
VARTQQVLASITTDKSRYAPGDTVSLTVNAANKTGSAISGGAVTLYFMTMQNAASASQAQ
TLNLGSGASSTLAFHWTAPSTDYTGYMVSAVATDSSGKALDSINVAVDVSSDWSRFPRYG
YMTNNSFGNQGLSTSQAASIMSSMSNYHIDGLQFYDWQYNHDQPLCGTVSAPCSSWTDDG
NQKTVYASAVKDLVTAAHNSNIVAMPYNAIFSADNGSCCGAPDYHTQGLGVSPSWGVYQD
TNHSKPLAFFQWDYMDPSNPGWQQYLMGQQNAAIQAFDFDGFHGDTFGDPDTVDYNYNGQ
PAGVASDSCTTDTDGAHSTTPVHNVAGSATWLSGTFPSFLSYAKSALGSGKYLMFNPVTY
DHAHCEANTSAVDLLYSELWPNDRDQYWDYGSLKTAIDQGFSESASASPTGRGKSLTVAA
YTDFANGGGGTFNTPDVLLLDSTLFASGGSHEELGDNGLMLDYQEYRAGATPMSASLSQS
VQNYYDFMTAYENLLRDGQTATNQTVAVSGQTVSSQATPGDVWAFTKQDADHEVIQLINM
VGQSSNLWQTGACDMCSHITTPHPAPTQLTNVPVKYYFKNTPKAVMFASPDYNNGTTYSV
PFTTGTDSGGSYVSFTVPSLNYWDMVYTSQTGPGDAPVLPGSGGTPTAPGAPGTPVASNI
TANSATLTWTAATAGSNPVAGYDVYRVGSPDAVVASSTGLSANVSGLSPSTSYQFYVKAK
DSTGLTGSASGTTSVTTASGGSTPPGAPGTPAASNVTTSAATLTWTAAAAGSNPISGYQV
FQVGNPDKVVASTGAGTLSATITGLSPSTAYQFYVKAKDSTGLTGSASGTTAVTTAGAPP
PSTAKVTYAVQSDWGSGMSVAVTITNTGSTAINGWTLGFAFPGNQQVGSGWNANWSQNGH
NVTATNQSFNGAIAPGASISIGFSGTYSGADAKPSAFTVNGLPATVG
Download sequence
Identical sequences C7Q3N8
479433.Caci_6973 WP_015795531.1.73754 gi|256396080|ref|YP_003117644.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]