SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256396081|ref|YP_003117645.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256396081|ref|YP_003117645.1|
Domain Number 1 Region: 832-934
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 3.07e-31
Family Cellulose-binding domain family II 0.00024
Further Details:      
 
Domain Number 2 Region: 637-829
Classification Level Classification E-value
Superfamily Fibronectin type III 8.3e-31
Family Fibronectin type III 0.00034
Further Details:      
 
Domain Number 3 Region: 68-160,202-393
Classification Level Classification E-value
Superfamily (Trans)glycosidases 1.39e-21
Family Amylase, catalytic domain 0.03
Further Details:      
 
Domain Number 4 Region: 505-629
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0000000000000138
Family Family 6 carbohydrate binding module, CBM6 0.022
Further Details:      
 
Domain Number 5 Region: 405-495
Classification Level Classification E-value
Superfamily Glycosyl hydrolase domain 0.000000000000198
Family alpha-Amylases, C-terminal beta-sheet domain 0.0076
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256396081|ref|YP_003117645.1|
Sequence length 938
Comment cellulose-binding family II protein [Catenulispora acidiphila DSM 44928]
Sequence
MAISRRDLLKVGGTVVVGGSLLSAGSGSAAAASRGRGALVGSTAVAVSAVGTDSVDRDSV
FTRGGSGPLYWSTYGYDYPNNNAQSQASWQANVTWVAKNLKPYGIDMACTDGWVDYTQAT
NSNGYILNYQDSWAMGWAGMSSYLSGLGLKMGVYYNPLWVTKSAYNDPSKTVVGRPDIPI
SSIVTAGDFFGGNKGTQEIYWVDVTKDGAKEFVQGYVNYFKQLGAVYLRGDFWAWYETGY
DQNEGTVGVAHGSANYATALGWISEAAGDGLEVSVVMPNLLNHGQNERRYGDLIRIDDDC
GSGGWNFLDGGRSSWQNYWTQWHTPFLGFTGFSDISGRGQMILDGDVLEMNSFGSDDERR
TALTLFAMAGSPLIVGDRSDNIGSYLSFWQNNDILNINKAGFVGKPYYHNANPFSSDPTS
RDPETWTGQLPDGTWLVALFNTTYSSVTKSIDFAGALGLAAGGTVHDVWNNTNLGQMTSY
SASLPMHGVSLIKITPAGSGAPVYQSQVAAWGGGAMFDNAASGFSGNGYVDGLGSVGARV
VFGVTGAGGTTPVTIRYANSGSAASLTISAKNVAGTVSGSTSVSLPGTGGAGTWSTVTVN
LALAAGTNLITLERTSTDSGSVNLDSIQVGASSGGSTPPGAPGTPAASAITSNAVTLTWS
AAAAGSNPIAGYQVYQVGSPDTVVASTAAGTLTATISGLTAATSYSFYVKAKDSAGTVGA
ASGTTAVTTAGSGGSTPPGAPGTPAASTITATAVTLTWSAAAAGSNAIAGYQVYEVGSPD
TVVASTAAGTLTATISGLMSATQYGFYVKAKDSAGALGAASATKTVTTAAVSAGAAVSYA
VQSDWGSGFSALVTITNTGTSAINNWTLGFTFAGNQHVTNGWNATWSQSGANVTASSESF
NGAIAPGASVQIGFTGTYSGANAKPTAFTINGQPATTQ
Download sequence
Identical sequences C7Q3N9
WP_015795532.1.73754 479433.Caci_6974 gi|256396081|ref|YP_003117645.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]