SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256396261|ref|YP_003117825.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256396261|ref|YP_003117825.1|
Domain Number 1 Region: 289-712
Classification Level Classification E-value
Superfamily Six-hairpin glycosidases 1.51e-62
Family Bacterial glucoamylase C-terminal domain-like 0.0000000272
Further Details:      
 
Domain Number 2 Region: 45-313
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 3.14e-57
Family Bacterial glucoamylase N-terminal domain-like 0.00000208
Further Details:      
 
Domain Number 3 Region: 736-921
Classification Level Classification E-value
Superfamily Fibronectin type III 1.75e-29
Family Fibronectin type III 0.00064
Further Details:      
 
Domain Number 4 Region: 1055-1153
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.000000515
Family Starch-binding domain 0.015
Further Details:      
 
Domain Number 5 Region: 924-995
Classification Level Classification E-value
Superfamily Starch-binding domain-like 0.0000204
Family Starch-binding domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256396261|ref|YP_003117825.1|
Sequence length 1160
Comment glucodextranase N [Catenulispora acidiphila DSM 44928]
Sequence
MLGRFISPPRVGRRWLRSSLSAFAGLSLATVGVWASSSPVARAGTASGGPGTASFWNETS
GVQGFATALSPSSKVWYTLGNGGLENVFYPQTDNPDTYGLQYYVTDGSSFTDGEATNTKH
AIALADPASLTFTQTNTAASGKYAITKTYVADPARSVILVKTTFTNNGSTPLYLYADYLP
QLNNQGMGNIGSTDAGGDLVASNGPMASALAASTPFSSASTGYVGTASSGTAQLATGHTL
GTVYSGVSSSGHIDQTAQIPVAASGSTTFTLALGFDTTSAAAVSDVSASLSSGFAAVQSS
FQAGWHTWMSGLTTAPASVANNAGLLTQYETSLMEVKADEDKNYVGAFVAAPVTPWGSTV
SADGGGGHGYHLVWTRDEYQMASALLAAGDKQDASDALTYLENYEETSSGQVKQNTWLNG
NAMWGGNQQDEEADPIILAYQLGRTGSADFAKIKLLASFIAANGPTTGQERWEENGGYSP
ATIASEIAGLVCASNIATANGDSADAAAWLAKAQSWAGSVAGWTYTTSGPYGSGSYFLRL
TPDGQPNSGASIGLANGGGNHDDRTVVDQSFLDLVRLGVMPATASQVTNSLAVDDAQIGV
NTPEGQIDHRYDFDGYGETSSGADYTGAGTGNPWPVLTGERGEYDVAAGNLTGAQSALTT
MAGAASDGQISEQVWAGTNGTGGFSLGRPDNSANPLMWAMAQYVRLAMDISAGQNLDTPT
VVCQTFNACSAAPTTKPAAPTNLTVTATHTTNVSLSWSGSSLAAGYKVYRATGTGPAALV
ATVASTAYTDTKLTASTAYSYSVTAYNNVGESGPSNTVTTTTKTPVPPPNAPTGLTVSAA
ASTTVDLTWTAATDTSGGTVGGYNIYRATGTGTAALVASTSGTSFTDTGLTPSTGYTYSV
TATDTDGNESAASNSVTATTTANNVEVVTVTVPSYTDQTGLTVYMAGTLSALGGGQGDWA
ANGIAFTRVDATHWRATIHAAGPTTLSYKYTLGGAWANDEETASCGYVGNRSMQINGGTE
ADTVANWAGPYTCGSSPPPPPGGGTGGNGGTTETIAVTVPADTPASAQVYLAGNLSVLGG
GQGDWAANGVLMSRVDATHFTASVSAANASTTLQYKYTLNGTWSNNEETGSCGYVQNRSL
TVNGGTQTDTVANWKGYGGC
Download sequence
Identical sequences C7Q6X1
WP_015795712.1.73754 479433.Caci_7155 gi|256396261|ref|YP_003117825.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]