SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256396308|ref|YP_003117872.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256396308|ref|YP_003117872.1|
Domain Number 1 Region: 45-185
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 2.67e-40
Family Cellulose-binding domain family III 0.0000851
Further Details:      
 
Domain Number 2 Region: 217-440
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 0.0000000000561
Family Glycosyl hydrolases family 16 0.034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256396308|ref|YP_003117872.1|
Sequence length 473
Comment type 3a cellulose-binding domain-containing protein [Catenulispora acidiphila DSM 44928]
Sequence
MRHTPRPRRSLAALTATGVAGAFGLTAAVLSTSAHAAGAPAALAYHVGSSGSDMVEPWFK
VTNTGGSALSLATVKIRYYFTIDSAPSYQFTCEWAQIGCGNVTGTIGTLPSPSATADHYL
EVGFTGGSLAPGASTGDLQLRMNAAGWAPVKQSNDYSFNASQTSYGSTGTITLAVNGAIV
SGTAPGGNPPPTSPSSSPSTSPSTSPSSGGGGSASGTLFDDFSYSGPSDPNLAAHGWAIR
TGAGGPGVQNSWAADTFSFPSDSSAQGGHVMNLAASTDGTTSGTKQAEIDTTQEKFFEGT
YAARVYFNDAPTTGTNGDHVNETFYTITPDNSLYSEDDFEYLPNGGWGGPADSMYTTSWY
SADAMDRVTTDTMGSLQGWHTLVATVYGGTVTYYIDGKQVFSSTGKYYPREAMTIDFNEW
FIDLPFTGARTWNEKVNWVYYAKGVAQSPTDVQNAVNGFYQGGTHFKDTVPSS
Download sequence
Identical sequences C7Q718
WP_015795759.1.73754 gi|256396308|ref|YP_003117872.1| 479433.Caci_7202

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]