SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256396313|ref|YP_003117877.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256396313|ref|YP_003117877.1|
Domain Number 1 Region: 122-452
Classification Level Classification E-value
Superfamily Subtilisin-like 2.09e-37
Family Serine-carboxyl proteinase, SCP 0.00032
Further Details:      
 
Domain Number 2 Region: 467-547
Classification Level Classification E-value
Superfamily Cadherin-like 0.0000000173
Family Cadherin 0.062
Further Details:      
 
Weak hits

Sequence:  gi|256396313|ref|YP_003117877.1|
Domain Number - Region: 558-656
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.00672
Family beta-mannanase CBM 0.082
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256396313|ref|YP_003117877.1|
Sequence length 710
Comment Ig family protein [Catenulispora acidiphila DSM 44928]
Sequence
MPSPHTERETIPVRISSRLRATARLATAVALGSALTVAVASGATASPAPAATTSASANLI
AAEAAGSAHASQPASTAANQGASHACSAVIVVGHQSCFALKRNGVHADAASVSPNSIPSG
VGYGPSQLQSAYNLTSAAASNGAGRTIALVDAYDYPTAAADLAAYRSAAGLPAGNFTKVN
QNGQTSPLPSAPPSGDDWTVEAALDMDMASAICPLCNIVLVEAQDDSSDGLYIAQAAAAA
RATYISNSWGGSESSTDPSSDNTYFKHATGTVTTVSAGDSDYGVSYPATSPNVVAVGGTA
LSTASNTRGWTESVWNTSTGSEGTGSGCSAYETQPSWQTALNMPAGCSKRIDNDVAADAD
PATGVAVYDTYNGDGGWNEVGGTSASSPMVAAMYALAGNAGANPAQDIYQHTSNFYDVTT
GKDASSCSPAYLCTAETGYDGPTGIGTPNGIAGLQTGGTSSETVSVSNPGNQTSTQGTAI
STLQISATDSASKALTYSATGLPAGLSINSSGAITGTPSAAGTSSVTVTASSGTASGSTS
FTWTVNGTGGGGCTAAQLLGNPGFETGSASPWTASAGVIDSSTSEPAHTGSWKAWMDGYG
TTHTDTVSQKVTIPAGCKTATFAFWLHIDTSETTTSTAFDKLSVQVLNSAGTVVSTLATY
SNLNHNTGYTQHSFSLASYIGQTITLKFTGAEDSSLQTSFVVDDNGLNVN
Download sequence
Identical sequences C7Q723
479433.Caci_7207 gi|256396313|ref|YP_003117877.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]