SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256397116|ref|YP_003118680.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256397116|ref|YP_003118680.1|
Domain Number 1 Region: 2-127
Classification Level Classification E-value
Superfamily N-terminal domain of MutM-like DNA repair proteins 5.1e-32
Family N-terminal domain of MutM-like DNA repair proteins 0.00015
Further Details:      
 
Domain Number 2 Region: 146-235
Classification Level Classification E-value
Superfamily S13-like H2TH domain 8.54e-25
Family Middle domain of MutM-like DNA repair proteins 0.0022
Further Details:      
 
Domain Number 3 Region: 238-286
Classification Level Classification E-value
Superfamily Glucocorticoid receptor-like (DNA-binding domain) 4.28e-17
Family C-terminal, Zn-finger domain of MutM-like DNA repair proteins 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|256397116|ref|YP_003118680.1|
Sequence length 290
Comment formamidopyrimidine-DNA glycosylase [Catenulispora acidiphila DSM 44928]
Sequence
MPELPEVEVVRRGLERWAVGRTVAAAEVLHPRAIRRHPDGPEDFAARAAGLTLLSAERRG
KFLWLPLGEGETSVGEAVTGHLGMSGQLLLQPSGTPDEKHLRIRFTFADDGPELRFVDQR
TFGGMALEKLEHDRQGVVVPASVVHIARDVLDPEFDVDFFHSELRRRNTGLKRALLDQTR
VSGIGNIYADEALWIARLHYDRPTSKMRRPDTDRVLEAAREVMTAALAVGGTSFDSLYVN
VNGESGYFARSLHAYGREGEPCERCGTPIKRESFMNRSSYFCPKCQRLPR
Download sequence
Identical sequences C7QGY9
gi|256397116|ref|YP_003118680.1| WP_015796564.1.73754 479433.Caci_8016

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]