SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256391357|ref|YP_003112921.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256391357|ref|YP_003112921.1|
Domain Number 1 Region: 164-432
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 1.64e-42
Family Protein kinases, catalytic subunit 0.00063
Further Details:      
 
Domain Number 2 Region: 520-654
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000654
Family Tetratricopeptide repeat (TPR) 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|256391357|ref|YP_003112921.1|
Sequence length 765
Comment serine/threonine protein kinase [Catenulispora acidiphila DSM 44928]
Sequence
MTACLEPGCDGTIDADGYCDTCGTAAAPAAARQGAAGAGGGHAASSRTATATSSRTGTAR
TSSTSASSRNSNSVSSRTRGSRGGSTGRSRRGNLGAGLIEVPPVPAKNPLTEIMANPQVP
EAKRYCSNCGAPVGRGRDGNPGRTEGFCRKCRTAFSFEPKLRAGEHVGQYEVLGCIAHGG
LGWIYLAKDNNVSGRWVVLKGLLDSGDADAMAAAAAERRFLAEVNHPSIVQILNFVQHPD
PTTGAPVGYIVMEYVGGSSLKQVRADFRDSGGQAGPLPVGQAIAYAIEILPAFGYLHSLG
LVYNDFKPDNIIQSEEQLKLIDMGGVIQMDDEDSAIYGTKGYQAPEIAQDGPSVESDLYT
VGRTLAVLTSLDSRAYQTTYLDSLPSPSEVPLFARHESFYKLLQRATDKDPAMRFGSAEQ
MAQQLTAVLREVLSLEEDKPHPGASVMFGPEVRVPSTSAERPELREVVRALPVPLVDRDD
PGAQFLAGLGAVDLVEQRFALEKSPLLAASQEIQLRLVLVATSEGDFSTAVRKLDEFENA
NGGDWRTFWYRGLIQLASGVITQAARMFTAVYDALPGEPAPKLALGACAELLGDFETASR
YYGMVWRTDTGYVSAAFGLARALLNTGRRDAAVRAFGAVPQTSTHHTAANEAALRALLVD
RDRDLSGADLSDIDARYSWLAARLDPEHANWLALEVLTAAGTRLGVQTPTDLVPGQKLID
RHVDDRSLRLGMEQAYRSLARLATDRAKRIELVDQANAVRPRTLI
Download sequence
Identical sequences C7QHQ5
WP_012786373.1.73754 479433.Caci_2161 gi|256391357|ref|YP_003112921.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]