SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256391867|ref|YP_003113431.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256391867|ref|YP_003113431.1|
Domain Number 1 Region: 22-268
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.1e-21
Family Polyphosphate kinase C-terminal domain 0.08
Further Details:      
 
Domain Number 2 Region: 252-416
Classification Level Classification E-value
Superfamily Phospholipase D/nuclease 1.47e-18
Family Nuclease 0.059
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256391867|ref|YP_003113431.1|
Sequence length 533
Comment phospholipase D [Catenulispora acidiphila DSM 44928]
Sequence
MDPRTWLITRHERGNPATRVDDEHAAQAAWSEGNLVEPLIHGAEYFAALSAAVRDMRAGD
LLLFTDWRGDGDETVDDEGTTVGSLLSSAARRGVHVRGLVWRSHVDRMRFSETENRHLSQ
EVEAAGGRCLLDTRVRPGGSHHQKFVVLRHAGRPEADVAFIGGIDLSHGRRDDARHEGDP
QTVEMADVYGKRPPWHDAQAMIHGPAVADAERVFRERWEDPAPVTRNPLHRARALLSREE
TKQTPLPAPLPPPQSCGPHAVELLRTYPKRTAGYPFAPEGERSVARSYLKVLSQARKLIY
LEDQYLWSREVAVPFAEALAANQGLHMIAVVPHHPAEQGRVAQSAMLAGRNQVLDMLRAA
GGDRFAVYGIENHAGTPVYVHAKITVIDDVWAAIGSDNLNLRSWSHDSELSCAVLDHTRD
PREPQDVGRAGDFPRRFARDLRLRLAREHLDRADGDDADLWDPTSAFQAFAHAAAELRDW
HSSNRTTARPPGRIRPYEAAPQSRTTTLWATPVYRTLFDPDGRPRALRRSGSF
Download sequence
Identical sequences C7PZD3
479433.Caci_2674 gi|256391867|ref|YP_003113431.1| WP_012786883.1.73754

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]