SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|256394532|ref|YP_003116096.1| from Catenulispora acidiphila DSM 44928

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|256394532|ref|YP_003116096.1|
Domain Number 1 Region: 7-270
Classification Level Classification E-value
Superfamily Cgl1923-like 1.11e-82
Family Cgl1923-like 0.0000775
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|256394532|ref|YP_003116096.1|
Sequence length 302
Comment hypothetical protein Caci_5396 [Catenulispora acidiphila DSM 44928]
Sequence
MIEFDGNMPDLVDPVAICAFEGWNDAGEAASNAVKHLAEAYAGAGRMFAALDGEDYYDYQ
VHRPMVAAVDDRRQVIWPTTRFSVVRAPARLLPGDAHEEPRDLVLVHGVEPNMRWRSFCE
EVLGLARDLGVGQIITLGAYLADVPHTRPTPVTGTSSDEAYQALFDVEPPTYEGPVGITG
VFQEACHHAGIPLMSFWAAVPHYVAHPPVPKATLALLRRLEDVLDLSVPTKRLAEEAQSW
EAGVDELAENDAEVGEYVRTLEEQRDNEDAADSPEASGEAIAREFERYLRRQERRRGSSE
EG
Download sequence
Identical sequences C7Q9A9
WP_015793984.1.73754 gi|256394532|ref|YP_003116096.1| 479433.Caci_5396

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]